Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PUN35_RS20610 Genome accession   NZ_CP117986
Coordinates   3851230..3851370 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. N3378-2at     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3846230..3856370
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUN35_RS20580 - 3846526..3846924 (+) 399 WP_014480710.1 YueI family protein -
  PUN35_RS20585 - 3847021..3847572 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  PUN35_RS20590 - 3847588..3849060 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  PUN35_RS20595 pdeH 3849196..3850425 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  PUN35_RS20600 - 3850401..3850769 (-) 369 WP_014477834.1 hypothetical protein -
  PUN35_RS20605 - 3850883..3851008 (-) 126 WP_003228793.1 hypothetical protein -
  PUN35_RS20610 degQ 3851230..3851370 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PUN35_RS20615 - 3851555..3852418 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  PUN35_RS20620 comX 3852420..3852641 (+) 222 WP_014480704.1 competence pheromone ComX -
  PUN35_RS20625 comP 3852657..3854969 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  PUN35_RS20630 comA 3855050..3855694 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PUN35_RS20635 - 3855713..3856093 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=788935 PUN35_RS20610 WP_003220708.1 3851230..3851370(+) (degQ) [Bacillus sp. N3378-2at]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=788935 PUN35_RS20610 WP_003220708.1 3851230..3851370(+) (degQ) [Bacillus sp. N3378-2at]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1