Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PUN35_RS02100 Genome accession   NZ_CP117986
Coordinates   388673..389056 (+) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus sp. N3378-2at     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 383673..394056
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUN35_RS02065 corA 384127..385080 (+) 954 WP_014480260.1 magnesium transporter CorA -
  PUN35_RS02070 - 385082..385279 (+) 198 WP_014480259.1 CBS domain-containing protein -
  PUN35_RS02075 comGA 385491..386561 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PUN35_RS02080 comGB 386548..387585 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  PUN35_RS02085 comGC 387599..387895 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PUN35_RS02090 comGD 387885..388316 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  PUN35_RS02095 comGE 388300..388647 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  PUN35_RS02100 comGF 388673..389056 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  PUN35_RS02105 comGG 389057..389431 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  PUN35_RS02110 - 389502..389681 (+) 180 WP_014480252.1 YqzE family protein -
  PUN35_RS02115 - 389723..390049 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  PUN35_RS02120 tapA 390321..391082 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  PUN35_RS02125 sipW 391066..391638 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PUN35_RS02130 tasA 391702..392487 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  PUN35_RS02135 sinR 392580..392915 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PUN35_RS02140 sinI 392949..393122 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=788878 PUN35_RS02100 WP_014480254.1 388673..389056(+) (comGF) [Bacillus sp. N3378-2at]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=788878 PUN35_RS02100 WP_014480254.1 388673..389056(+) (comGF) [Bacillus sp. N3378-2at]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984