Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PUN35_RS02140 Genome accession   NZ_CP117986
Coordinates   392949..393122 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. N3378-2at     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 387949..398122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUN35_RS02095 comGE 388300..388647 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  PUN35_RS02100 comGF 388673..389056 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  PUN35_RS02105 comGG 389057..389431 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  PUN35_RS02110 - 389502..389681 (+) 180 WP_014480252.1 YqzE family protein -
  PUN35_RS02115 - 389723..390049 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  PUN35_RS02120 tapA 390321..391082 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  PUN35_RS02125 sipW 391066..391638 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PUN35_RS02130 tasA 391702..392487 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  PUN35_RS02135 sinR 392580..392915 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PUN35_RS02140 sinI 392949..393122 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  PUN35_RS02145 - 393305..394099 (-) 795 WP_014480249.1 YqhG family protein -
  PUN35_RS02150 - 394120..395793 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  PUN35_RS02155 gcvT 396235..397323 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=788881 PUN35_RS02140 WP_003230187.1 392949..393122(-) (sinI) [Bacillus sp. N3378-2at]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=788881 PUN35_RS02140 WP_003230187.1 392949..393122(-) (sinI) [Bacillus sp. N3378-2at]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1