Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   PT966_RS12220 Genome accession   NZ_CP117945
Coordinates   2516071..2516385 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain ZY1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2511071..2521385
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT966_RS12175 (PT966_12175) sinI 2511754..2511927 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PT966_RS12180 (PT966_12180) sinR 2511961..2512296 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PT966_RS12185 (PT966_12185) - 2512344..2513129 (-) 786 WP_003153102.1 TasA family protein -
  PT966_RS12190 (PT966_12190) - 2513193..2513777 (-) 585 WP_003153100.1 signal peptidase I -
  PT966_RS12195 (PT966_12195) tapA 2513749..2514420 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PT966_RS12200 (PT966_12200) - 2514679..2515008 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PT966_RS12205 (PT966_12205) - 2515048..2515227 (-) 180 WP_003153093.1 YqzE family protein -
  PT966_RS12210 (PT966_12210) comGG 2515284..2515661 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PT966_RS12215 (PT966_12215) comGF 2515662..2516057 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PT966_RS12220 (PT966_12220) comGE 2516071..2516385 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PT966_RS12225 (PT966_12225) comGD 2516369..2516806 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  PT966_RS12230 (PT966_12230) comGC 2516796..2517104 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  PT966_RS12235 (PT966_12235) comGB 2517109..2518146 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  PT966_RS12240 (PT966_12240) comGA 2518133..2519203 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  PT966_RS12245 (PT966_12245) - 2519395..2520345 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=788426 PT966_RS12220 WP_015388003.1 2516071..2516385(-) (comGE) [Bacillus velezensis strain ZY1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=788426 PT966_RS12220 WP_015388003.1 2516071..2516385(-) (comGE) [Bacillus velezensis strain ZY1]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481