Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PT966_RS12175 Genome accession   NZ_CP117945
Coordinates   2511754..2511927 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain ZY1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2506754..2516927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT966_RS12160 (PT966_12160) gcvT 2507572..2508672 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  PT966_RS12165 (PT966_12165) - 2509095..2510765 (+) 1671 WP_003153107.1 SNF2-related protein -
  PT966_RS12170 (PT966_12170) - 2510783..2511577 (+) 795 WP_014305407.1 YqhG family protein -
  PT966_RS12175 (PT966_12175) sinI 2511754..2511927 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PT966_RS12180 (PT966_12180) sinR 2511961..2512296 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PT966_RS12185 (PT966_12185) - 2512344..2513129 (-) 786 WP_003153102.1 TasA family protein -
  PT966_RS12190 (PT966_12190) - 2513193..2513777 (-) 585 WP_003153100.1 signal peptidase I -
  PT966_RS12195 (PT966_12195) tapA 2513749..2514420 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PT966_RS12200 (PT966_12200) - 2514679..2515008 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PT966_RS12205 (PT966_12205) - 2515048..2515227 (-) 180 WP_003153093.1 YqzE family protein -
  PT966_RS12210 (PT966_12210) comGG 2515284..2515661 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PT966_RS12215 (PT966_12215) comGF 2515662..2516057 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PT966_RS12220 (PT966_12220) comGE 2516071..2516385 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PT966_RS12225 (PT966_12225) comGD 2516369..2516806 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=788423 PT966_RS12175 WP_003153105.1 2511754..2511927(+) (sinI) [Bacillus velezensis strain ZY1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=788423 PT966_RS12175 WP_003153105.1 2511754..2511927(+) (sinI) [Bacillus velezensis strain ZY1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702