Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   PO845_RS11920 Genome accession   NZ_CP117857
Coordinates   2498931..2499368 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain PT4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2493931..2504368
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO845_RS11870 (PO845_11870) sinI 2494315..2494488 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PO845_RS11875 (PO845_11875) sinR 2494522..2494857 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO845_RS11880 (PO845_11880) - 2494905..2495690 (-) 786 WP_007408329.1 TasA family protein -
  PO845_RS11885 (PO845_11885) - 2495755..2496339 (-) 585 WP_061860711.1 signal peptidase I -
  PO845_RS11890 (PO845_11890) tapA 2496311..2496982 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  PO845_RS11895 (PO845_11895) - 2497241..2497570 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  PO845_RS11900 (PO845_11900) - 2497610..2497789 (-) 180 WP_003153093.1 YqzE family protein -
  PO845_RS11905 (PO845_11905) comGG 2497846..2498223 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO845_RS11910 (PO845_11910) comGF 2498224..2498619 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  PO845_RS11915 (PO845_11915) comGE 2498633..2498947 (-) 315 WP_280955415.1 competence type IV pilus minor pilin ComGE -
  PO845_RS11920 (PO845_11920) comGD 2498931..2499368 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  PO845_RS11925 (PO845_11925) comGC 2499358..2499666 (-) 309 WP_081002171.1 competence type IV pilus major pilin ComGC Machinery gene
  PO845_RS11930 (PO845_11930) comGB 2499671..2500708 (-) 1038 WP_060674612.1 competence type IV pilus assembly protein ComGB Machinery gene
  PO845_RS11935 (PO845_11935) comGA 2500695..2501765 (-) 1071 WP_060674614.1 competence type IV pilus ATPase ComGA Machinery gene
  PO845_RS11940 (PO845_11940) - 2501958..2502908 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  PO845_RS11945 (PO845_11945) - 2503054..2504355 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=788045 PO845_RS11920 WP_012117983.1 2498931..2499368(-) (comGD) [Bacillus velezensis strain PT4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=788045 PO845_RS11920 WP_012117983.1 2498931..2499368(-) (comGD) [Bacillus velezensis strain PT4]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAGATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572