Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   PO845_RS11905 Genome accession   NZ_CP117857
Coordinates   2497846..2498223 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain PT4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2492846..2503223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO845_RS11865 (PO845_11865) - 2493344..2494138 (+) 795 WP_156240427.1 YqhG family protein -
  PO845_RS11870 (PO845_11870) sinI 2494315..2494488 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PO845_RS11875 (PO845_11875) sinR 2494522..2494857 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO845_RS11880 (PO845_11880) - 2494905..2495690 (-) 786 WP_007408329.1 TasA family protein -
  PO845_RS11885 (PO845_11885) - 2495755..2496339 (-) 585 WP_061860711.1 signal peptidase I -
  PO845_RS11890 (PO845_11890) tapA 2496311..2496982 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  PO845_RS11895 (PO845_11895) - 2497241..2497570 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  PO845_RS11900 (PO845_11900) - 2497610..2497789 (-) 180 WP_003153093.1 YqzE family protein -
  PO845_RS11905 (PO845_11905) comGG 2497846..2498223 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO845_RS11910 (PO845_11910) comGF 2498224..2498619 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  PO845_RS11915 (PO845_11915) comGE 2498633..2498947 (-) 315 WP_280955415.1 competence type IV pilus minor pilin ComGE -
  PO845_RS11920 (PO845_11920) comGD 2498931..2499368 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  PO845_RS11925 (PO845_11925) comGC 2499358..2499666 (-) 309 WP_081002171.1 competence type IV pilus major pilin ComGC Machinery gene
  PO845_RS11930 (PO845_11930) comGB 2499671..2500708 (-) 1038 WP_060674612.1 competence type IV pilus assembly protein ComGB Machinery gene
  PO845_RS11935 (PO845_11935) comGA 2500695..2501765 (-) 1071 WP_060674614.1 competence type IV pilus ATPase ComGA Machinery gene
  PO845_RS11940 (PO845_11940) - 2501958..2502908 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=788044 PO845_RS11905 WP_015417814.1 2497846..2498223(-) (comGG) [Bacillus velezensis strain PT4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=788044 PO845_RS11905 WP_015417814.1 2497846..2498223(-) (comGG) [Bacillus velezensis strain PT4]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504