Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PO845_RS11870 Genome accession   NZ_CP117857
Coordinates   2494315..2494488 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain PT4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2489315..2499488
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO845_RS11855 (PO845_11855) gcvT 2490128..2491228 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  PO845_RS11860 (PO845_11860) - 2491652..2493322 (+) 1671 WP_015417810.1 SNF2-related protein -
  PO845_RS11865 (PO845_11865) - 2493344..2494138 (+) 795 WP_156240427.1 YqhG family protein -
  PO845_RS11870 (PO845_11870) sinI 2494315..2494488 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  PO845_RS11875 (PO845_11875) sinR 2494522..2494857 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO845_RS11880 (PO845_11880) - 2494905..2495690 (-) 786 WP_007408329.1 TasA family protein -
  PO845_RS11885 (PO845_11885) - 2495755..2496339 (-) 585 WP_061860711.1 signal peptidase I -
  PO845_RS11890 (PO845_11890) tapA 2496311..2496982 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  PO845_RS11895 (PO845_11895) - 2497241..2497570 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  PO845_RS11900 (PO845_11900) - 2497610..2497789 (-) 180 WP_003153093.1 YqzE family protein -
  PO845_RS11905 (PO845_11905) comGG 2497846..2498223 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO845_RS11910 (PO845_11910) comGF 2498224..2498619 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  PO845_RS11915 (PO845_11915) comGE 2498633..2498947 (-) 315 WP_280955415.1 competence type IV pilus minor pilin ComGE -
  PO845_RS11920 (PO845_11920) comGD 2498931..2499368 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=788042 PO845_RS11870 WP_003153105.1 2494315..2494488(+) (sinI) [Bacillus velezensis strain PT4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=788042 PO845_RS11870 WP_003153105.1 2494315..2494488(+) (sinI) [Bacillus velezensis strain PT4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702