Detailed information    

insolico Bioinformatically predicted

Overview


Name   ccpA   Type   Regulator
Locus tag   MGCS35957_RS02895 Genome accession   NZ_CP117288
Coordinates   545715..546716 (+) Length   333 a.a.
NCBI ID   WP_003049927.1    Uniprot ID   A0A9X5LWR8
Organism   Streptococcus dysgalactiae subsp. equisimilis strain MGCS35957     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 468924..548930 545715..546716 within 0


Gene organization within MGE regions


Location: 468924..548930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGCS35957_RS02475 (MGCS35957_01012) metG 469141..471138 (+) 1998 WP_049520067.1 methionine--tRNA ligase -
  MGCS35957_RS02480 (MGCS35957_01014) nrdF 471671..472684 (+) 1014 WP_003055629.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  MGCS35957_RS02485 (MGCS35957_01016) nrdI 472688..473161 (+) 474 WP_003055616.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  MGCS35957_RS02490 (MGCS35957_01018) nrdE 473145..475331 (+) 2187 WP_003055626.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  MGCS35957_RS02495 (MGCS35957_01020) brnQ 475629..476963 (+) 1335 WP_003055639.1 branched-chain amino acid transport system II carrier protein -
  MGCS35957_RS02500 (MGCS35957_01024) - 477362..477715 (+) 354 WP_084916410.1 hypothetical protein -
  MGCS35957_RS02505 (MGCS35957_01026) - 478026..478262 (+) 237 WP_032460623.1 DUF2829 domain-containing protein -
  MGCS35957_RS02510 (MGCS35957_01028) - 478255..478953 (+) 699 WP_003054338.1 3-oxoacyl-ACP reductase -
  MGCS35957_RS02515 (MGCS35957_01030) - 478950..479192 (+) 243 WP_042357856.1 DUF3977 family protein -
  MGCS35957_RS02520 (MGCS35957_01032) - 479210..479659 (+) 450 WP_084916411.1 ASCH domain-containing protein -
  MGCS35957_RS02525 (MGCS35957_01034) - 479661..480620 (+) 960 WP_003054341.1 Gfo/Idh/MocA family oxidoreductase -
  MGCS35957_RS02530 (MGCS35957_01036) - 480954..482291 (+) 1338 WP_046159276.1 MFS transporter -
  MGCS35957_RS02535 (MGCS35957_01038) glmU 482463..483845 (+) 1383 WP_084916412.1 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU -
  MGCS35957_RS02540 (MGCS35957_01040) - 483876..484430 (+) 555 WP_003059987.1 NUDIX hydrolase -
  MGCS35957_RS02545 (MGCS35957_01042) macP 484431..484682 (+) 252 WP_003054365.1 cell wall synthase accessory phosphoprotein MacP -
  MGCS35957_RS02550 (MGCS35957_01044) - 484700..485395 (+) 696 WP_003054376.1 5'-methylthioadenosine/adenosylhomocysteine nucleosidase -
  MGCS35957_RS02555 (MGCS35957_01046) - 485468..486115 (-) 648 WP_003059888.1 metal-dependent transcriptional regulator -
  MGCS35957_RS02560 (MGCS35957_01050) - 486261..487193 (+) 933 WP_003062287.1 metal ABC transporter substrate-binding protein -
  MGCS35957_RS02565 (MGCS35957_01052) - 487258..487983 (+) 726 WP_003054363.1 metal ABC transporter ATP-binding protein -
  MGCS35957_RS02570 (MGCS35957_01054) - 487984..488832 (+) 849 WP_003054335.1 metal ABC transporter permease -
  MGCS35957_RS02575 (MGCS35957_01056) - 488963..489769 (-) 807 WP_003054349.1 peptidylprolyl isomerase -
  MGCS35957_RS02580 (MGCS35957_01058) - 489987..492395 (+) 2409 WP_037590009.1 DNA translocase FtsK -
  MGCS35957_RS02585 (MGCS35957_01060) - 492464..492817 (-) 354 WP_037587264.1 DUF3397 domain-containing protein -
  MGCS35957_RS02590 (MGCS35957_01062) rplK 493060..493485 (+) 426 WP_003049875.1 50S ribosomal protein L11 -
  MGCS35957_RS02595 (MGCS35957_01064) rplA 493591..494280 (+) 690 WP_003049876.1 50S ribosomal protein L1 -
  MGCS35957_RS02600 (MGCS35957_01066) - 494783..494950 (-) 168 WP_003054374.1 hypothetical protein -
  MGCS35957_RS02605 (MGCS35957_01068) pyrH 495232..495960 (+) 729 WP_003049878.1 UMP kinase -
  MGCS35957_RS02610 (MGCS35957_01070) frr 495989..496546 (+) 558 WP_003054381.1 ribosome recycling factor -
  MGCS35957_RS02615 (MGCS35957_01072) - 496655..497512 (+) 858 WP_003054345.1 S1 RNA-binding domain-containing protein -
  MGCS35957_RS02620 (MGCS35957_01074) msrA 497585..498094 (+) 510 WP_003054395.1 peptide-methionine (S)-S-oxide reductase MsrA -
  MGCS35957_RS02625 (MGCS35957_01076) - 498091..498306 (+) 216 WP_003054340.1 YozE family protein -
  MGCS35957_RS02630 (MGCS35957_01078) - 498466..499701 (+) 1236 WP_003054361.1 LysM domain-containing protein -
  MGCS35957_RS02635 (MGCS35957_01080) - 500012..501784 (+) 1773 WP_003054339.1 oleate hydratase -
  MGCS35957_RS02640 (MGCS35957_01082) - 501945..503006 (+) 1062 WP_003054347.1 PhoH family protein -
  MGCS35957_RS02645 (MGCS35957_01084) - 503053..503628 (+) 576 WP_003054351.1 uracil-DNA glycosylase family protein -
  MGCS35957_RS02650 (MGCS35957_01086) ybeY 503787..504284 (+) 498 WP_003054373.1 rRNA maturation RNase YbeY -
  MGCS35957_RS02655 (MGCS35957_01088) - 504265..504672 (+) 408 WP_003054389.1 diacylglycerol kinase -
  MGCS35957_RS02660 (MGCS35957_01090) era 504793..505689 (+) 897 WP_002985743.1 GTPase Era -
  MGCS35957_RS02665 (MGCS35957_01092) - 505710..506186 (+) 477 WP_002993018.1 NUDIX domain-containing protein -
  MGCS35957_RS02670 (MGCS35957_01094) - 506495..506746 (-) 252 WP_080589767.1 hypothetical protein -
  MGCS35957_RS02675 - 507047..507265 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein -
  MGCS35957_RS02680 (MGCS35957_01098) - 507546..509259 (-) 1714 Protein_484 peptide cleavage/export ABC transporter -
  MGCS35957_RS02685 (MGCS35957_01100) - 509557..509784 (+) 228 WP_022554332.1 Blp family class II bacteriocin -
  MGCS35957_RS02690 (MGCS35957_01102) - 509833..510150 (+) 318 WP_002994587.1 hypothetical protein -
  MGCS35957_RS02695 (MGCS35957_01104) - 510333..511354 (+) 1022 Protein_487 IS3 family transposase -
  MGCS35957_RS02700 (MGCS35957_01106) - 511568..512986 (+) 1419 WP_231873805.1 IS1182 family transposase -
  MGCS35957_RS02710 (MGCS35957_01110) comE/blpR 514607..515356 (+) 750 WP_030126108.1 response regulator transcription factor Regulator
  MGCS35957_RS02720 (MGCS35957_01114) - 515698..516831 (-) 1134 WP_275902597.1 ISAs1-like element IS1548 family transposase -
  MGCS35957_RS02725 (MGCS35957_01116) - 517061..518017 (+) 957 WP_046166194.1 GHKL domain-containing protein -
  MGCS35957_RS02730 (MGCS35957_01118) - 518165..518290 (-) 126 WP_011017462.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  MGCS35957_RS02735 (MGCS35957_01122) - 518367..519731 (-) 1365 WP_084916305.1 bacteriocin secretion accessory protein -
  MGCS35957_RS02740 (MGCS35957_01124) comA/nlmT 519742..521895 (-) 2154 WP_084916306.1 peptide cleavage/export ABC transporter Regulator
  MGCS35957_RS02745 (MGCS35957_01126) - 522182..522409 (+) 228 WP_002992018.1 Blp family class II bacteriocin -
  MGCS35957_RS02750 (MGCS35957_01128) - 522422..522622 (+) 201 WP_003060803.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  MGCS35957_RS02755 (MGCS35957_01130) - 522916..523110 (+) 195 WP_002990768.1 hypothetical protein -
  MGCS35957_RS02760 (MGCS35957_01132) - 523158..523439 (+) 282 WP_011054252.1 hypothetical protein -
  MGCS35957_RS02765 (MGCS35957_01134) - 523633..524043 (+) 411 WP_003061293.1 hypothetical protein -
  MGCS35957_RS02770 - 524290..524537 (+) 248 Protein_501 hypothetical protein -
  MGCS35957_RS02775 (MGCS35957_01136) - 524559..524813 (+) 255 WP_014612089.1 CPBP family intramembrane glutamic endopeptidase -
  MGCS35957_RS02780 (MGCS35957_01140) - 525198..525962 (+) 765 WP_003061232.1 hypothetical protein -
  MGCS35957_RS02785 (MGCS35957_01142) - 526112..527054 (-) 943 Protein_504 hypothetical protein -
  MGCS35957_RS02790 shp2 527123..527191 (-) 69 WP_134771781.1 peptide pheromone SHP2 -
  MGCS35957_RS02795 (MGCS35957_01144) rgg2 527281..528135 (+) 855 Protein_506 quorum-sensing system transcriptional regulator Rgg2 -
  MGCS35957_RS02800 (MGCS35957_01146) mutM 528317..529144 (+) 828 WP_084916308.1 DNA-formamidopyrimidine glycosylase -
  MGCS35957_RS02805 (MGCS35957_01148) coaE 529123..529734 (+) 612 WP_172453883.1 dephospho-CoA kinase -
  MGCS35957_RS02810 (MGCS35957_01150) - 530102..530803 (+) 702 WP_003056868.1 ABC transporter ATP-binding protein -
  MGCS35957_RS02815 (MGCS35957_01152) - 530793..532430 (+) 1638 WP_022554345.1 hypothetical protein -
  MGCS35957_RS02820 (MGCS35957_01154) - 532540..534042 (+) 1503 WP_084916309.1 helicase HerA-like domain-containing protein -
  MGCS35957_RS02825 (MGCS35957_01156) - 534206..535423 (+) 1218 WP_223846048.1 multidrug efflux MFS transporter -
  MGCS35957_RS02830 rpmG 535420..535566 (+) 147 WP_003047126.1 50S ribosomal protein L33 -
  MGCS35957_RS02835 (MGCS35957_01158) secG 535612..535848 (+) 237 WP_003047129.1 preprotein translocase subunit SecG -
  MGCS35957_RS02840 (MGCS35957_01160) rnr 535945..538275 (+) 2331 WP_084916311.1 ribonuclease R -
  MGCS35957_RS02845 (MGCS35957_01162) smpB 538278..538745 (+) 468 WP_022554349.1 SsrA-binding protein SmpB -
  MGCS35957_RS02850 (MGCS35957_01164) - 538924..539280 (+) 357 WP_003053910.1 hypothetical protein -
  MGCS35957_RS02855 (MGCS35957_01166) - 539373..540721 (+) 1349 WP_111678974.1 IS3 family transposase -
  MGCS35957_RS02860 (MGCS35957_01168) - 540778..541704 (-) 927 WP_003053920.1 glycosyltransferase family 2 protein -
  MGCS35957_RS11140 (MGCS35957_01170) - 541841..543025 (-) 1185 Protein_520 DNA/RNA non-specific endonuclease -
  MGCS35957_RS02880 (MGCS35957_01172) - 543363..543737 (-) 375 WP_046177445.1 VOC family protein -
  MGCS35957_RS02885 (MGCS35957_01174) - 543747..544412 (-) 666 WP_003058626.1 NAD(P)H-dependent oxidoreductase -
  MGCS35957_RS02890 (MGCS35957_01176) - 544456..545541 (-) 1086 WP_003058632.1 Xaa-Pro peptidase family protein -
  MGCS35957_RS02895 (MGCS35957_01178) ccpA 545715..546716 (+) 1002 WP_003049927.1 catabolite control protein A Regulator
  MGCS35957_RS02900 (MGCS35957_01180) - 546870..548333 (+) 1464 WP_012766666.1 alpha-amylase -

Sequence


Protein


Download         Length: 333 a.a.        Molecular weight: 36683.74 Da        Isoelectric Point: 5.7248

>NTDB_id=783378 MGCS35957_RS02895 WP_003049927.1 545715..546716(+) (ccpA) [Streptococcus dysgalactiae subsp. equisimilis strain MGCS35957]
MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFS
ILAKGIDDIAAMYKYNIVLASSDEDDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPIVLAGTVDLDHQLPS
VNIDYKAAVSNVVDILAENHQSIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEANYSYKEGFELAQRVINSG
ATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVVQYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEI
LLNHGIKKRGTTK

Nucleotide


Download         Length: 1002 bp        

>NTDB_id=783378 MGCS35957_RS02895 WP_003049927.1 545715..546716(+) (ccpA) [Streptococcus dysgalactiae subsp. equisimilis strain MGCS35957]
ATGAATACAGATGATACCATCACGATTTATGACGTTGCCCGTGAAGCTGGTGTTTCTATGGCAACTGTTAGTCGTGTTGT
TAATGGCAATAAAAACGTTAAGGAAAACACGCGTAAGAAAGTTTTAGAAGTCATTGACCGCCTAGATTATCGTCCAAATG
CTGTCGCACGTGGTCTCGCCAGCAAAAAAACAACAACCGTCGGGGTTGTGATTCCGAATATTGCAAACAGTTATTTTTCT
ATTTTAGCCAAAGGTATTGATGATATCGCCGCTATGTATAAATATAATATTGTACTTGCCTCTAGTGATGAGGATGATGA
CAAGGAGGTTAACGTTGTTAATACCCTCTTTGCTAAGCAAGTTGACGGTATTATCTTTATGGGGCACCACTTGACTGAAA
AAATCCGTGCGGAATTTTCACGCTCACGCACCCCGATTGTTTTAGCAGGGACAGTTGACCTTGATCATCAATTACCAAGT
GTTAATATTGACTATAAGGCAGCTGTGTCTAATGTGGTTGATATTTTGGCAGAAAACCATCAGAGCATTGCCTTTGTGTC
AGGACCACTTATTGATGACATCAATGGTAAAGTACGTTTGGCGGGTTACAAAGAAGGCTTGAAGCACAACAAACTTGACT
TCAAAGAAGGACTTGTTTTTGAAGCTAACTATTCTTATAAAGAAGGTTTTGAATTGGCACAACGTGTGATTAACTCAGGA
GCAACAGCAGCTTATGTGGCTGAAGATGAGTTAGCAGCGGGTCTTTTAAATGGTTTGTTTGAAGCAGGCAAACGCGTTCC
AGAAGATTTTGAAATCATCACAAGCAATGATTCACCAGTTGTTCAATATACCCGTCCAAACTTGAGTTCTATCAGCCAAC
CCGTTTACGACTTGGGAGCTGTCAGCATGCGGATGTTGACTAAAATCATGAACAAAGAAGAGTTGGAAGAAAAAGAAATT
CTTTTGAATCATGGTATTAAAAAACGCGGAACCACTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccpA Streptococcus gordonii str. Challis substr. CH1

77.778

100

0.778

  ccpA Streptococcus pneumoniae D39

75.976

100

0.76

  ccpA Lactococcus lactis subsp. lactis strain DGCC12653

55.589

99.399

0.553