Detailed information    

insolico Bioinformatically predicted

Overview


Name   ccpA   Type   Regulator
Locus tag   MGCS36044_RS02990 Genome accession   NZ_CP117287
Coordinates   552856..553857 (+) Length   333 a.a.
NCBI ID   WP_003049927.1    Uniprot ID   A0A9X5LWR8
Organism   Streptococcus dysgalactiae subsp. equisimilis strain MGCS36044     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 476065..556071 552856..553857 within 0


Gene organization within MGE regions


Location: 476065..556071
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGCS36044_RS02560 (MGCS36044_01028) metG 476282..478279 (+) 1998 WP_049520067.1 methionine--tRNA ligase -
  MGCS36044_RS02565 (MGCS36044_01030) nrdF 478812..479825 (+) 1014 WP_003055629.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  MGCS36044_RS02570 (MGCS36044_01032) nrdI 479829..480302 (+) 474 WP_003055616.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  MGCS36044_RS02575 (MGCS36044_01034) nrdE 480286..482472 (+) 2187 WP_003055626.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  MGCS36044_RS02580 (MGCS36044_01036) brnQ 482770..484104 (+) 1335 WP_003055639.1 branched-chain amino acid transport system II carrier protein -
  MGCS36044_RS02585 (MGCS36044_01040) - 484503..484856 (+) 354 WP_084916410.1 hypothetical protein -
  MGCS36044_RS02590 (MGCS36044_01042) - 485167..485403 (+) 237 WP_032460623.1 DUF2829 domain-containing protein -
  MGCS36044_RS02595 (MGCS36044_01044) - 485396..486094 (+) 699 WP_003054338.1 3-oxoacyl-ACP reductase -
  MGCS36044_RS02600 (MGCS36044_01046) - 486091..486333 (+) 243 WP_042357856.1 DUF3977 family protein -
  MGCS36044_RS02605 (MGCS36044_01048) - 486351..486800 (+) 450 WP_084916411.1 ASCH domain-containing protein -
  MGCS36044_RS02610 (MGCS36044_01050) - 486802..487761 (+) 960 WP_003054341.1 Gfo/Idh/MocA family protein -
  MGCS36044_RS02615 (MGCS36044_01052) - 488095..489432 (+) 1338 WP_046159276.1 MFS transporter -
  MGCS36044_RS02620 (MGCS36044_01054) glmU 489604..490986 (+) 1383 WP_084916412.1 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU -
  MGCS36044_RS02625 (MGCS36044_01056) - 491017..491571 (+) 555 WP_003059987.1 NUDIX domain-containing protein -
  MGCS36044_RS02630 (MGCS36044_01058) macP 491572..491823 (+) 252 WP_003054365.1 cell wall synthase accessory phosphoprotein MacP -
  MGCS36044_RS02635 (MGCS36044_01060) - 491841..492536 (+) 696 WP_003054376.1 5'-methylthioadenosine/adenosylhomocysteine nucleosidase -
  MGCS36044_RS02640 (MGCS36044_01062) - 492609..493256 (-) 648 WP_003059888.1 metal-dependent transcriptional regulator -
  MGCS36044_RS02645 (MGCS36044_01066) - 493402..494334 (+) 933 WP_003062287.1 metal ABC transporter substrate-binding protein -
  MGCS36044_RS02650 (MGCS36044_01068) - 494399..495124 (+) 726 WP_003054363.1 metal ABC transporter ATP-binding protein -
  MGCS36044_RS02655 (MGCS36044_01070) - 495125..495973 (+) 849 WP_003054335.1 metal ABC transporter permease -
  MGCS36044_RS02660 (MGCS36044_01072) - 496104..496910 (-) 807 WP_003054349.1 peptidylprolyl isomerase -
  MGCS36044_RS02665 (MGCS36044_01074) - 497128..499536 (+) 2409 WP_037590009.1 DNA translocase FtsK -
  MGCS36044_RS02670 (MGCS36044_01076) - 499605..499958 (-) 354 WP_037587264.1 DUF3397 domain-containing protein -
  MGCS36044_RS02675 (MGCS36044_01078) rplK 500201..500626 (+) 426 WP_003049875.1 50S ribosomal protein L11 -
  MGCS36044_RS02680 (MGCS36044_01080) rplA 500732..501421 (+) 690 WP_003049876.1 50S ribosomal protein L1 -
  MGCS36044_RS02685 - 501696..501830 (-) 135 WP_003054384.1 hypothetical protein -
  MGCS36044_RS02690 (MGCS36044_01082) - 501924..502091 (-) 168 WP_003054374.1 hypothetical protein -
  MGCS36044_RS02695 (MGCS36044_01084) pyrH 502373..503101 (+) 729 WP_003049878.1 UMP kinase -
  MGCS36044_RS02700 (MGCS36044_01086) frr 503130..503687 (+) 558 WP_003054381.1 ribosome recycling factor -
  MGCS36044_RS02705 (MGCS36044_01088) - 503796..504653 (+) 858 WP_003054345.1 CvfB family protein -
  MGCS36044_RS02710 (MGCS36044_01090) msrA 504726..505235 (+) 510 WP_003054395.1 peptide-methionine (S)-S-oxide reductase MsrA -
  MGCS36044_RS02715 (MGCS36044_01092) - 505232..505447 (+) 216 WP_003054340.1 YozE family protein -
  MGCS36044_RS02720 (MGCS36044_01094) - 505607..506842 (+) 1236 WP_003054361.1 LysM peptidoglycan-binding domain-containing protein -
  MGCS36044_RS02725 (MGCS36044_01096) - 507153..508925 (+) 1773 WP_003054339.1 oleate hydratase -
  MGCS36044_RS02730 (MGCS36044_01098) - 509086..510147 (+) 1062 WP_003054347.1 PhoH family protein -
  MGCS36044_RS02735 (MGCS36044_01100) - 510194..510769 (+) 576 WP_003054351.1 uracil-DNA glycosylase family protein -
  MGCS36044_RS02740 (MGCS36044_01102) ybeY 510928..511425 (+) 498 WP_003054373.1 rRNA maturation RNase YbeY -
  MGCS36044_RS02745 (MGCS36044_01104) - 511406..511813 (+) 408 WP_003054389.1 diacylglycerol kinase family protein -
  MGCS36044_RS02750 (MGCS36044_01106) era 511934..512830 (+) 897 WP_002985743.1 GTPase Era -
  MGCS36044_RS02755 (MGCS36044_01108) - 512851..513327 (+) 477 WP_002993018.1 NUDIX hydrolase -
  MGCS36044_RS02760 (MGCS36044_01110) - 513636..513887 (-) 252 WP_080589767.1 hypothetical protein -
  MGCS36044_RS02765 - 514188..514406 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein -
  MGCS36044_RS02770 (MGCS36044_01114) - 514603..516400 (-) 1798 Protein_489 peptide cleavage/export ABC transporter -
  MGCS36044_RS02775 (MGCS36044_01116) - 516698..516925 (+) 228 WP_022554332.1 Blp family class II bacteriocin -
  MGCS36044_RS02780 (MGCS36044_01118) - 516974..517291 (+) 318 WP_002994587.1 hypothetical protein -
  MGCS36044_RS02785 (MGCS36044_01120) - 517411..518495 (+) 1085 Protein_492 IS3 family transposase -
  MGCS36044_RS02790 (MGCS36044_01122) - 518709..520127 (+) 1419 WP_275902596.1 IS1182 family transposase -
  MGCS36044_RS02800 (MGCS36044_01126) comE/blpR 521748..522497 (+) 750 WP_030126108.1 response regulator transcription factor Regulator
  MGCS36044_RS02810 (MGCS36044_01130) - 522839..523972 (-) 1134 WP_275902597.1 ISAs1-like element IS1548 family transposase -
  MGCS36044_RS02815 (MGCS36044_01132) - 524202..525158 (+) 957 WP_046166194.1 sensor histidine kinase -
  MGCS36044_RS02820 (MGCS36044_01134) - 525306..525431 (-) 126 WP_011017462.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  MGCS36044_RS02825 (MGCS36044_01138) - 525508..526872 (-) 1365 WP_084916305.1 bacteriocin secretion accessory protein -
  MGCS36044_RS02830 (MGCS36044_01140) comA/nlmT 526883..529036 (-) 2154 WP_084916306.1 peptide cleavage/export ABC transporter Regulator
  MGCS36044_RS02835 (MGCS36044_01142) - 529323..529550 (+) 228 WP_002992018.1 Blp family class II bacteriocin -
  MGCS36044_RS02840 (MGCS36044_01144) - 529563..529763 (+) 201 WP_003060803.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  MGCS36044_RS02845 (MGCS36044_01146) - 530057..530251 (+) 195 WP_002990768.1 hypothetical protein -
  MGCS36044_RS02850 (MGCS36044_01148) - 530299..530580 (+) 282 WP_011054252.1 hypothetical protein -
  MGCS36044_RS02855 (MGCS36044_01150) - 530774..531184 (+) 411 WP_003061293.1 hypothetical protein -
  MGCS36044_RS02860 - 531431..531678 (+) 248 Protein_506 hypothetical protein -
  MGCS36044_RS02865 (MGCS36044_01152) - 531700..531954 (+) 255 WP_014612089.1 CPBP family intramembrane glutamic endopeptidase -
  MGCS36044_RS02870 (MGCS36044_01156) - 532366..533103 (+) 738 WP_228113938.1 hypothetical protein -
  MGCS36044_RS02875 (MGCS36044_01158) - 533253..534179 (-) 927 Protein_509 hypothetical protein -
  MGCS36044_RS02880 shp2 534264..534332 (-) 69 WP_134771781.1 peptide pheromone SHP2 -
  MGCS36044_RS02885 (MGCS36044_01160) rgg2 534422..535276 (+) 855 Protein_511 quorum-sensing system transcriptional regulator Rgg2 -
  MGCS36044_RS02890 (MGCS36044_01162) mutM 535458..536285 (+) 828 WP_084916308.1 DNA-formamidopyrimidine glycosylase -
  MGCS36044_RS02895 (MGCS36044_01164) coaE 536264..536875 (+) 612 WP_172453883.1 dephospho-CoA kinase -
  MGCS36044_RS02900 - 536890..537123 (-) 234 WP_159335598.1 hypothetical protein -
  MGCS36044_RS02905 (MGCS36044_01166) - 537243..537944 (+) 702 WP_003056868.1 ATP-binding cassette domain-containing protein -
  MGCS36044_RS02910 (MGCS36044_01168) - 537934..539571 (+) 1638 WP_022554345.1 hypothetical protein -
  MGCS36044_RS02915 (MGCS36044_01170) - 539681..541183 (+) 1503 WP_084916309.1 helicase HerA-like domain-containing protein -
  MGCS36044_RS02920 (MGCS36044_01172) - 541362..542564 (+) 1203 WP_080147973.1 multidrug efflux MFS transporter -
  MGCS36044_RS02925 rpmG 542561..542707 (+) 147 WP_003047126.1 50S ribosomal protein L33 -
  MGCS36044_RS02930 (MGCS36044_01174) secG 542753..542989 (+) 237 WP_003047129.1 preprotein translocase subunit SecG -
  MGCS36044_RS02935 (MGCS36044_01176) rnr 543086..545416 (+) 2331 WP_084916311.1 ribonuclease R -
  MGCS36044_RS02940 (MGCS36044_01178) smpB 545419..545886 (+) 468 WP_022554349.1 SsrA-binding protein SmpB -
  MGCS36044_RS02945 (MGCS36044_01180) - 546065..546421 (+) 357 WP_003053910.1 hypothetical protein -
  MGCS36044_RS02950 (MGCS36044_01182) - 546514..547862 (+) 1349 WP_111678974.1 IS3 family transposase -
  MGCS36044_RS02955 (MGCS36044_01184) - 547919..548845 (-) 927 WP_003053920.1 glycosyltransferase family 2 protein -
  MGCS36044_RS10620 (MGCS36044_01186) - 548982..550166 (-) 1185 Protein_526 DNA/RNA non-specific endonuclease -
  MGCS36044_RS02975 (MGCS36044_01188) - 550504..550878 (-) 375 WP_046177445.1 VOC family protein -
  MGCS36044_RS02980 (MGCS36044_01190) - 550888..551553 (-) 666 WP_003058626.1 NAD(P)H-dependent oxidoreductase -
  MGCS36044_RS02985 (MGCS36044_01192) - 551597..552682 (-) 1086 WP_003058632.1 M24 family metallopeptidase -
  MGCS36044_RS02990 (MGCS36044_01194) ccpA 552856..553857 (+) 1002 WP_003049927.1 catabolite control protein A Regulator
  MGCS36044_RS02995 (MGCS36044_01196) - 554011..555474 (+) 1464 WP_012766666.1 alpha-amylase -

Sequence


Protein


Download         Length: 333 a.a.        Molecular weight: 36683.74 Da        Isoelectric Point: 5.7248

>NTDB_id=783320 MGCS36044_RS02990 WP_003049927.1 552856..553857(+) (ccpA) [Streptococcus dysgalactiae subsp. equisimilis strain MGCS36044]
MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFS
ILAKGIDDIAAMYKYNIVLASSDEDDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPIVLAGTVDLDHQLPS
VNIDYKAAVSNVVDILAENHQSIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEANYSYKEGFELAQRVINSG
ATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVVQYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEI
LLNHGIKKRGTTK

Nucleotide


Download         Length: 1002 bp        

>NTDB_id=783320 MGCS36044_RS02990 WP_003049927.1 552856..553857(+) (ccpA) [Streptococcus dysgalactiae subsp. equisimilis strain MGCS36044]
ATGAATACAGATGATACCATCACGATTTATGACGTTGCCCGTGAAGCTGGTGTTTCTATGGCAACTGTTAGTCGTGTTGT
TAATGGCAATAAAAACGTTAAGGAAAACACGCGTAAGAAAGTTTTAGAAGTCATTGACCGCCTAGATTATCGTCCAAATG
CTGTCGCACGTGGTCTCGCCAGCAAAAAAACAACAACCGTCGGGGTTGTGATTCCGAATATTGCAAACAGTTATTTTTCT
ATTTTAGCCAAAGGTATTGATGATATCGCCGCTATGTATAAATATAATATTGTACTTGCCTCTAGTGATGAGGATGATGA
CAAGGAGGTTAACGTTGTTAATACCCTCTTTGCTAAGCAAGTTGACGGTATTATCTTTATGGGGCACCACTTGACTGAAA
AAATCCGTGCGGAATTTTCACGCTCACGCACCCCGATTGTTTTAGCAGGGACAGTTGACCTTGATCATCAATTACCAAGT
GTTAATATTGACTATAAGGCAGCTGTGTCTAATGTGGTTGATATTTTGGCAGAAAACCATCAGAGCATTGCCTTTGTGTC
AGGACCACTTATTGATGACATCAATGGTAAAGTACGTTTGGCGGGTTACAAAGAAGGCTTGAAGCACAACAAACTTGACT
TCAAAGAAGGACTTGTTTTTGAAGCTAACTATTCTTATAAAGAAGGTTTTGAATTGGCACAACGTGTGATTAACTCAGGA
GCAACAGCAGCTTATGTGGCTGAAGATGAGTTAGCAGCGGGTCTTTTAAATGGTTTGTTTGAAGCAGGCAAACGCGTTCC
AGAAGATTTTGAAATCATCACAAGCAATGATTCACCAGTTGTTCAATATACCCGTCCAAACTTGAGTTCTATCAGCCAAC
CCGTTTACGACTTGGGAGCTGTCAGCATGCGGATGTTGACTAAAATCATGAACAAAGAAGAGTTGGAAGAAAAAGAAATT
CTTTTGAATCATGGTATTAAAAAACGCGGAACCACTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccpA Streptococcus gordonii str. Challis substr. CH1

77.778

100

0.778

  ccpA Streptococcus pneumoniae D39

75.976

100

0.76

  ccpA Lactococcus lactis subsp. lactis strain DGCC12653

55.589

99.399

0.553