Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   MGGS36055_RS09715 Genome accession   NZ_CP117286
Coordinates   1944555..1945487 (-) Length   310 a.a.
NCBI ID   WP_003060110.1    Uniprot ID   A0A9X8T5Q4
Organism   Streptococcus dysgalactiae subsp. equisimilis strain MGGS36055     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1891107..1968578 1944555..1945487 within 0


Gene organization within MGE regions


Location: 1891107..1968578
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MGGS36055_RS09460 (MGGS36055_03812) - 1891627..1892946 (+) 1320 Protein_1801 FAD-containing oxidoreductase -
  MGGS36055_RS09465 (MGGS36055_03814) - 1893039..1895375 (-) 2337 WP_015017393.1 endonuclease MutS2 -
  MGGS36055_RS09470 (MGGS36055_03816) - 1895531..1896076 (-) 546 WP_003061010.1 CvpA family protein -
  MGGS36055_RS09475 (MGGS36055_03818) - 1896079..1896387 (-) 309 WP_003052702.1 hypothetical protein -
  MGGS36055_RS09480 (MGGS36055_03820) rnhC 1896544..1897443 (+) 900 WP_042357991.1 ribonuclease HIII -
  MGGS36055_RS09485 (MGGS36055_03822) lepB 1897465..1898058 (+) 594 WP_012767541.1 signal peptidase I -
  MGGS36055_RS09490 (MGGS36055_03824) - 1898118..1900571 (+) 2454 WP_015017395.1 ATP-dependent RecD-like DNA helicase -
  MGGS36055_RS09495 (MGGS36055_03826) - 1900662..1901150 (+) 489 WP_003056836.1 hypothetical protein -
  MGGS36055_RS09500 (MGGS36055_03828) dinB 1901239..1902336 (-) 1098 WP_015017396.1 DNA polymerase IV -
  MGGS36055_RS09505 (MGGS36055_03830) pflB 1902545..1904872 (+) 2328 WP_003056840.1 formate C-acetyltransferase -
  MGGS36055_RS09510 (MGGS36055_03832) - 1904977..1905429 (+) 453 WP_003056842.1 GNAT family N-acetyltransferase -
  MGGS36055_RS09515 (MGGS36055_03834) - 1905553..1907460 (-) 1908 WP_015017398.1 glycoside hydrolase family 13 protein -
  MGGS36055_RS09520 (MGGS36055_03836) - 1907547..1909118 (-) 1572 WP_003062409.1 extracellular solute-binding protein -
  MGGS36055_RS09525 (MGGS36055_03838) - 1909174..1909836 (-) 663 WP_003060890.1 DUF624 domain-containing protein -
  MGGS36055_RS09530 (MGGS36055_03840) - 1909848..1910747 (-) 900 WP_003059927.1 carbohydrate ABC transporter permease -
  MGGS36055_RS09535 (MGGS36055_03842) - 1910760..1911698 (-) 939 WP_003056823.1 ABC transporter permease subunit -
  MGGS36055_RS09540 (MGGS36055_03844) - 1912305..1913336 (+) 1032 WP_003056847.1 LacI family DNA-binding transcriptional regulator -
  MGGS36055_RS09545 (MGGS36055_03846) - 1913448..1914383 (-) 936 WP_003056846.1 serine hydrolase domain-containing protein -
  MGGS36055_RS09550 (MGGS36055_03848) - 1914380..1915132 (-) 753 WP_003056834.1 CppA N-terminal domain-containing protein -
  MGGS36055_RS09555 (MGGS36055_03850) - 1915394..1916299 (+) 906 WP_003060954.1 sulfite exporter TauE/SafE family protein -
  MGGS36055_RS09560 (MGGS36055_03852) gla 1916403..1917251 (-) 849 WP_003054261.1 aquaglyceroporin Gla -
  MGGS36055_RS09565 (MGGS36055_03854) - 1917378..1919660 (+) 2283 WP_003061570.1 Xaa-Pro dipeptidyl-peptidase -
  MGGS36055_RS09570 (MGGS36055_03856) - 1919733..1920125 (-) 393 WP_003054260.1 pyridoxamine 5'-phosphate oxidase family protein -
  MGGS36055_RS09575 (MGGS36055_03858) - 1920295..1920516 (-) 222 WP_003060222.1 helix-turn-helix transcriptional regulator -
  MGGS36055_RS09580 (MGGS36055_03860) - 1920686..1921060 (+) 375 WP_003056692.1 helix-turn-helix transcriptional regulator -
  MGGS36055_RS09585 (MGGS36055_03864) - 1921623..1922102 (-) 480 WP_227985708.1 hypothetical protein -
  MGGS36055_RS09590 (MGGS36055_03866) - 1922333..1923523 (-) 1191 WP_002983018.1 site-specific integrase -
  MGGS36055_RS09595 (MGGS36055_03868) - 1923599..1923802 (-) 204 WP_002983016.1 excisionase -
  MGGS36055_RS09600 (MGGS36055_03872) - 1924231..1924482 (-) 252 WP_002983011.1 helix-turn-helix domain-containing protein -
  MGGS36055_RS09605 (MGGS36055_03874) - 1924463..1924906 (-) 444 WP_009220377.1 sigma-70 family RNA polymerase sigma factor -
  MGGS36055_RS09610 (MGGS36055_03876) - 1925411..1926877 (-) 1467 WP_049519736.1 energy-coupling factor ABC transporter ATP-binding protein -
  MGGS36055_RS09615 (MGGS36055_03878) - 1926905..1927594 (-) 690 WP_231846835.1 energy-coupling factor transporter transmembrane component T -
  MGGS36055_RS09620 (MGGS36055_03880) - 1927636..1928271 (-) 636 WP_227985709.1 MptD family putative ECF transporter S component -
  MGGS36055_RS09625 (MGGS36055_03882) - 1928274..1930016 (-) 1743 WP_003060864.1 ABC transporter ATP-binding protein -
  MGGS36055_RS09630 (MGGS36055_03884) - 1930009..1931796 (-) 1788 WP_002982991.1 ABC transporter ATP-binding protein -
  MGGS36055_RS09635 (MGGS36055_03886) - 1931996..1932610 (+) 615 WP_002982989.1 TetR/AcrR family transcriptional regulator -
  MGGS36055_RS09640 (MGGS36055_03888) - 1932941..1933549 (+) 609 WP_002982976.1 replication protein -
  MGGS36055_RS09645 (MGGS36055_03890) - 1933524..1933769 (+) 246 WP_002982972.1 DUF3173 family protein -
  MGGS36055_RS09650 (MGGS36055_03892) - 1933771..1934922 (+) 1152 WP_032467247.1 site-specific integrase -
  MGGS36055_RS09655 (MGGS36055_03894) - 1935000..1935299 (+) 300 WP_002982967.1 YbaB/EbfC family nucleoid-associated protein -
  MGGS36055_RS09660 (MGGS36055_03896) - 1935356..1936093 (-) 738 WP_002982961.1 MerR family transcriptional regulator -
  MGGS36055_RS09665 (MGGS36055_03898) - 1936246..1936833 (-) 588 WP_014612583.1 3'-5' exonuclease -
  MGGS36055_RS09670 (MGGS36055_03900) - 1936881..1937411 (-) 531 WP_002992269.1 DUF536 domain-containing protein -
  MGGS36055_RS09675 (MGGS36055_03902) - 1937615..1938790 (+) 1176 WP_015017408.1 NAD(P)/FAD-dependent oxidoreductase -
  MGGS36055_RS09680 (MGGS36055_03904) - 1938850..1939098 (-) 249 WP_042357993.1 hypothetical protein -
  MGGS36055_RS09685 (MGGS36055_03906) rpsN 1939446..1939715 (+) 270 WP_003052772.1 30S ribosomal protein S14 -
  MGGS36055_RS09690 (MGGS36055_03908) tsaD 1940045..1941061 (-) 1017 WP_003056674.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD -
  MGGS36055_RS09695 (MGGS36055_03910) rimI 1941051..1941476 (-) 426 WP_042357994.1 ribosomal protein S18-alanine N-acetyltransferase -
  MGGS36055_RS09700 (MGGS36055_03912) tsaB 1941478..1942176 (-) 699 WP_003062223.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB -
  MGGS36055_RS09705 (MGGS36055_03914) - 1942462..1942692 (+) 231 WP_003056704.1 DNA-dependent RNA polymerase subunit epsilon -
  MGGS36055_RS09710 (MGGS36055_03916) rnjA 1942694..1944376 (+) 1683 WP_003056700.1 ribonuclease J1 -
  MGGS36055_RS09715 (MGGS36055_03918) amiF 1944555..1945487 (-) 933 WP_003060110.1 ATP-binding cassette domain-containing protein Regulator
  MGGS36055_RS09720 (MGGS36055_03920) oppD 1945480..1946532 (-) 1053 WP_012767556.1 ABC transporter ATP-binding protein Regulator
  MGGS36055_RS09725 (MGGS36055_03922) - 1946544..1947575 (-) 1032 WP_138084043.1 ABC transporter permease -
  MGGS36055_RS09730 (MGGS36055_03924) - 1947585..1948499 (-) 915 WP_003052794.1 ABC transporter permease -
  MGGS36055_RS09735 (MGGS36055_03926) - 1948767..1950422 (-) 1656 WP_003058031.1 peptide ABC transporter substrate-binding protein -
  MGGS36055_RS09740 (MGGS36055_03928) glnA 1950655..1952001 (-) 1347 WP_015017410.1 type I glutamate--ammonia ligase -
  MGGS36055_RS09745 (MGGS36055_03930) - 1952039..1952410 (-) 372 WP_003058022.1 MerR family transcriptional regulator -
  MGGS36055_RS09750 (MGGS36055_03932) - 1952487..1953008 (-) 522 WP_003052804.1 aromatic acid exporter family protein -
  MGGS36055_RS09755 (MGGS36055_03934) - 1953500..1954696 (-) 1197 WP_003058011.1 phosphoglycerate kinase -
  MGGS36055_RS09760 (MGGS36055_03936) - 1954880..1955737 (-) 858 WP_003058027.1 5'-nucleotidase, lipoprotein e(P4) family -
  MGGS36055_RS09765 (MGGS36055_03938) gap 1955921..1956931 (-) 1011 WP_003052840.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  MGGS36055_RS09770 (MGGS36055_03940) fusA 1957271..1959349 (-) 2079 WP_003058029.1 elongation factor G -
  MGGS36055_RS09775 (MGGS36055_03942) rpsG 1959853..1960323 (-) 471 WP_002992078.1 30S ribosomal protein S7 -
  MGGS36055_RS09780 (MGGS36055_03944) rpsL 1960344..1960757 (-) 414 WP_003052844.1 30S ribosomal protein S12 -
  MGGS36055_RS09785 (MGGS36055_03946) - 1961018..1963639 (-) 2622 WP_042357995.1 SEC10/PgrA surface exclusion domain-containing protein -
  MGGS36055_RS09790 (MGGS36055_03948) purR 1963630..1964469 (-) 840 WP_003058017.1 pur operon repressor -
  MGGS36055_RS09795 (MGGS36055_03950) - 1964569..1965507 (-) 939 WP_012767558.1 3'-5' exoribonuclease YhaM family protein -
  MGGS36055_RS09800 (MGGS36055_03952) - 1965497..1966768 (-) 1272 WP_003060141.1 DNA recombination protein RmuC -
  MGGS36055_RS09805 (MGGS36055_03954) - 1966770..1967402 (-) 633 WP_003056070.1 thiamine diphosphokinase -
  MGGS36055_RS09810 (MGGS36055_03956) rpe 1967395..1968057 (-) 663 WP_015017416.1 ribulose-phosphate 3-epimerase -

Sequence


Protein


Download         Length: 310 a.a.        Molecular weight: 35203.02 Da        Isoelectric Point: 6.6437

>NTDB_id=783287 MGGS36055_RS09715 WP_003060110.1 1944555..1945487(-) (amiF) [Streptococcus dysgalactiae subsp. equisimilis strain MGGS36055]
MNDNRKKLVELKNVSLTFNKGKKNEVKAIDNVSFDIYEGEVFGLVGESGSGKTTVGRAILKLYDINEGEIIFNGETVSHL
KGKDLRTFRKDAQMIFQDPQASLNGRMKIRDIVAEGLDIHGLTASKAEREERVQELLDLVGLNKDHLTRYPHEFSGGQRQ
RIGIARALAVKPKFIIADEPISALDVSIQAQVVNLMQKLQHKRGLTYLFIAHDLSMVKYISDRIGVMHWGKMLEIGTSDD
VYNHPIHPYTKSLLSAIPEPDPDKERQRVADVYDPSQELDGQERQMHEITPGHFVLATQEEADQYRREYH

Nucleotide


Download         Length: 933 bp        

>NTDB_id=783287 MGGS36055_RS09715 WP_003060110.1 1944555..1945487(-) (amiF) [Streptococcus dysgalactiae subsp. equisimilis strain MGGS36055]
ATGAATGATAATCGAAAGAAATTAGTAGAGTTAAAAAATGTCTCCTTAACTTTCAATAAGGGAAAGAAAAACGAAGTCAA
AGCCATTGATAATGTGAGCTTTGATATTTATGAAGGGGAAGTGTTTGGACTGGTTGGGGAATCCGGATCAGGAAAAACAA
CTGTTGGTCGCGCCATTTTAAAGCTTTATGATATTAATGAAGGGGAAATTATTTTTAATGGTGAAACCGTTTCTCATTTG
AAAGGGAAAGACTTGCGGACCTTTCGTAAGGATGCTCAGATGATTTTCCAAGATCCTCAGGCTAGTCTTAACGGCCGTAT
GAAAATCAGAGATATTGTGGCAGAAGGGCTAGATATTCATGGACTCACAGCTTCAAAGGCAGAACGAGAAGAACGCGTGC
AAGAACTCCTTGATTTGGTTGGGTTGAACAAGGACCATTTGACACGTTACCCCCATGAATTTTCTGGTGGTCAACGTCAA
CGGATTGGGATTGCCCGTGCTTTGGCAGTTAAACCTAAATTTATCATTGCTGATGAACCTATCTCAGCTCTCGATGTGTC
GATTCAGGCCCAGGTAGTTAACTTGATGCAAAAGCTTCAGCACAAACGTGGATTGACCTATCTTTTTATTGCCCATGACT
TGTCAATGGTCAAATACATTTCTGACCGTATCGGAGTCATGCACTGGGGTAAAATGTTGGAGATTGGGACCTCAGATGAT
GTCTATAATCATCCTATTCATCCTTATACCAAGAGCCTACTCTCGGCTATTCCTGAACCAGATCCAGACAAAGAACGTCA
GCGGGTGGCTGATGTATATGACCCAAGTCAAGAATTGGACGGCCAAGAACGTCAGATGCATGAGATTACGCCAGGCCATT
TTGTCTTAGCTACCCAAGAAGAAGCAGACCAATATCGACGGGAGTATCATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMD-9

54.098

98.387

0.532

  amiF Streptococcus thermophilus LMG 18311

53.77

98.387

0.529

  amiF Streptococcus salivarius strain HSISS4

53.443

98.387

0.526