Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   PO847_RS13170 Genome accession   NZ_CP117197
Coordinates   2651372..2651809 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain 3ZT     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2646372..2656809
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO847_RS13120 (PO847_13120) sinI 2646755..2646928 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PO847_RS13125 (PO847_13125) sinR 2646962..2647297 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO847_RS13130 (PO847_13130) - 2647345..2648130 (-) 786 WP_007408329.1 TasA family protein -
  PO847_RS13135 (PO847_13135) - 2648195..2648779 (-) 585 WP_022552967.1 signal peptidase I -
  PO847_RS13140 (PO847_13140) tapA 2648751..2649422 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PO847_RS13145 (PO847_13145) - 2649681..2650010 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PO847_RS13150 (PO847_13150) - 2650051..2650230 (-) 180 WP_022552966.1 YqzE family protein -
  PO847_RS13155 (PO847_13155) comGG 2650287..2650664 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO847_RS13160 (PO847_13160) comGF 2650665..2651060 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PO847_RS13165 (PO847_13165) comGE 2651074..2651388 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  PO847_RS13170 (PO847_13170) comGD 2651372..2651809 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PO847_RS13175 (PO847_13175) comGC 2651799..2652107 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  PO847_RS13180 (PO847_13180) comGB 2652112..2653149 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  PO847_RS13185 (PO847_13185) comGA 2653136..2654206 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  PO847_RS13190 (PO847_13190) - 2654399..2655349 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  PO847_RS13195 (PO847_13195) - 2655495..2656796 (+) 1302 WP_022552961.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=782775 PO847_RS13170 WP_007612572.1 2651372..2651809(-) (comGD) [Bacillus velezensis strain 3ZT]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=782775 PO847_RS13170 WP_007612572.1 2651372..2651809(-) (comGD) [Bacillus velezensis strain 3ZT]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559