Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PO847_RS13120 Genome accession   NZ_CP117197
Coordinates   2646755..2646928 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain 3ZT     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2641755..2651928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO847_RS13105 (PO847_13105) gcvT 2642568..2643668 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  PO847_RS13110 (PO847_13110) - 2644092..2645762 (+) 1671 WP_038461530.1 SNF2-related protein -
  PO847_RS13115 (PO847_13115) - 2645784..2646578 (+) 795 WP_014418368.1 YqhG family protein -
  PO847_RS13120 (PO847_13120) sinI 2646755..2646928 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PO847_RS13125 (PO847_13125) sinR 2646962..2647297 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO847_RS13130 (PO847_13130) - 2647345..2648130 (-) 786 WP_007408329.1 TasA family protein -
  PO847_RS13135 (PO847_13135) - 2648195..2648779 (-) 585 WP_022552967.1 signal peptidase I -
  PO847_RS13140 (PO847_13140) tapA 2648751..2649422 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PO847_RS13145 (PO847_13145) - 2649681..2650010 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PO847_RS13150 (PO847_13150) - 2650051..2650230 (-) 180 WP_022552966.1 YqzE family protein -
  PO847_RS13155 (PO847_13155) comGG 2650287..2650664 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO847_RS13160 (PO847_13160) comGF 2650665..2651060 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PO847_RS13165 (PO847_13165) comGE 2651074..2651388 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  PO847_RS13170 (PO847_13170) comGD 2651372..2651809 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=782771 PO847_RS13120 WP_014418369.1 2646755..2646928(+) (sinI) [Bacillus velezensis strain 3ZT]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=782771 PO847_RS13120 WP_014418369.1 2646755..2646928(+) (sinI) [Bacillus velezensis strain 3ZT]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719