Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PO847_RS13120 | Genome accession | NZ_CP117197 |
| Coordinates | 2646755..2646928 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain 3ZT | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2641755..2651928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO847_RS13105 (PO847_13105) | gcvT | 2642568..2643668 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PO847_RS13110 (PO847_13110) | - | 2644092..2645762 (+) | 1671 | WP_038461530.1 | SNF2-related protein | - |
| PO847_RS13115 (PO847_13115) | - | 2645784..2646578 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| PO847_RS13120 (PO847_13120) | sinI | 2646755..2646928 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| PO847_RS13125 (PO847_13125) | sinR | 2646962..2647297 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| PO847_RS13130 (PO847_13130) | - | 2647345..2648130 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| PO847_RS13135 (PO847_13135) | - | 2648195..2648779 (-) | 585 | WP_022552967.1 | signal peptidase I | - |
| PO847_RS13140 (PO847_13140) | tapA | 2648751..2649422 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PO847_RS13145 (PO847_13145) | - | 2649681..2650010 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| PO847_RS13150 (PO847_13150) | - | 2650051..2650230 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| PO847_RS13155 (PO847_13155) | comGG | 2650287..2650664 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| PO847_RS13160 (PO847_13160) | comGF | 2650665..2651060 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| PO847_RS13165 (PO847_13165) | comGE | 2651074..2651388 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| PO847_RS13170 (PO847_13170) | comGD | 2651372..2651809 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=782771 PO847_RS13120 WP_014418369.1 2646755..2646928(+) (sinI) [Bacillus velezensis strain 3ZT]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=782771 PO847_RS13120 WP_014418369.1 2646755..2646928(+) (sinI) [Bacillus velezensis strain 3ZT]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |