Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   PPM45_RS15580 Genome accession   NZ_CP116870
Coordinates   3022880..3023020 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain Master_strain     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3017880..3028020
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM45_RS15555 yuxO 3018193..3018573 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PPM45_RS15560 comA 3018592..3019236 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PPM45_RS15565 comP 3019317..3021626 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  PPM45_RS15570 comX 3021641..3021808 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PPM45_RS15575 comQ 3021796..3022695 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PPM45_RS15580 degQ 3022880..3023020 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PPM45_RS15585 - 3023242..3023367 (+) 126 WP_003228793.1 hypothetical protein -
  PPM45_RS15590 - 3023481..3023849 (+) 369 WP_003243784.1 hypothetical protein -
  PPM45_RS15595 pdeH 3023825..3025054 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PPM45_RS15600 pncB 3025191..3026663 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  PPM45_RS15605 pncA 3026679..3027230 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  PPM45_RS15610 yueI 3027327..3027725 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=780741 PPM45_RS15580 WP_003220708.1 3022880..3023020(-) (degQ) [Bacillus subtilis subsp. subtilis strain Master_strain]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=780741 PPM45_RS15580 WP_003220708.1 3022880..3023020(-) (degQ) [Bacillus subtilis subsp. subtilis strain Master_strain]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1