Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   PPM45_RS15570 Genome accession   NZ_CP116870
Coordinates   3021641..3021808 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain Master_strain     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3016641..3026808
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM45_RS15540 mrpE 3017036..3017512 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  PPM45_RS15545 mrpF 3017512..3017796 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  PPM45_RS15550 mnhG 3017780..3018154 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  PPM45_RS15555 yuxO 3018193..3018573 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PPM45_RS15560 comA 3018592..3019236 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PPM45_RS15565 comP 3019317..3021626 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  PPM45_RS15570 comX 3021641..3021808 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PPM45_RS15575 comQ 3021796..3022695 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PPM45_RS15580 degQ 3022880..3023020 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PPM45_RS15585 - 3023242..3023367 (+) 126 WP_003228793.1 hypothetical protein -
  PPM45_RS15590 - 3023481..3023849 (+) 369 WP_003243784.1 hypothetical protein -
  PPM45_RS15595 pdeH 3023825..3025054 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PPM45_RS15600 pncB 3025191..3026663 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=780739 PPM45_RS15570 WP_003242801.1 3021641..3021808(-) (comX) [Bacillus subtilis subsp. subtilis strain Master_strain]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=780739 PPM45_RS15570 WP_003242801.1 3021641..3021808(-) (comX) [Bacillus subtilis subsp. subtilis strain Master_strain]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1