Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PPM45_RS12015 | Genome accession | NZ_CP116870 |
| Coordinates | 2363324..2363497 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain Master_strain | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2358324..2368497
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPM45_RS12000 | gcvT | 2359123..2360211 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PPM45_RS12005 | hepAA | 2360653..2362326 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| PPM45_RS12010 | yqhG | 2362347..2363141 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| PPM45_RS12015 | sinI | 2363324..2363497 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| PPM45_RS12020 | sinR | 2363531..2363866 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| PPM45_RS12025 | tasA | 2363959..2364744 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| PPM45_RS12030 | sipW | 2364808..2365380 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| PPM45_RS12035 | tapA | 2365364..2366125 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PPM45_RS12040 | yqzG | 2366397..2366723 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| PPM45_RS12045 | spoIITA | 2366765..2366944 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| PPM45_RS12050 | comGG | 2367015..2367389 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| PPM45_RS12055 | comGF | 2367390..2367773 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| PPM45_RS12060 | comGE | 2367799..2368146 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=780715 PPM45_RS12015 WP_003230187.1 2363324..2363497(+) (sinI) [Bacillus subtilis subsp. subtilis strain Master_strain]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=780715 PPM45_RS12015 WP_003230187.1 2363324..2363497(+) (sinI) [Bacillus subtilis subsp. subtilis strain Master_strain]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |