Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PNF30_RS04390 Genome accession   NZ_CP116774
Coordinates   888829..888969 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain SRCM125915     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 883829..893969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PNF30_RS04365 (PNF30_04365) - 884060..884467 (+) 408 WP_272510764.1 YueI family protein -
  PNF30_RS04370 (PNF30_04370) - 884528..885079 (+) 552 WP_095409470.1 cysteine hydrolase family protein -
  PNF30_RS04375 (PNF30_04375) - 885097..886569 (+) 1473 WP_144483393.1 nicotinate phosphoribosyltransferase -
  PNF30_RS04380 (PNF30_04380) - 886707..887933 (+) 1227 WP_272511014.1 EAL and HDOD domain-containing protein -
  PNF30_RS04385 (PNF30_04385) - 887967..888323 (-) 357 WP_272510765.1 inner spore coat protein -
  PNF30_RS04390 (PNF30_04390) degQ 888829..888969 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  PNF30_RS04395 (PNF30_04395) - 889121..890044 (+) 924 WP_203128792.1 polyprenyl synthetase family protein -
  PNF30_RS04400 (PNF30_04400) comX 890022..890192 (+) 171 WP_012011107.1 competence pheromone ComX -
  PNF30_RS04405 (PNF30_04405) comP 890206..892512 (+) 2307 WP_272510766.1 ATP-binding protein Regulator
  PNF30_RS04410 (PNF30_04410) comA 892593..893234 (+) 642 WP_095409464.1 response regulator transcription factor Regulator
  PNF30_RS04415 (PNF30_04415) - 893258..893647 (+) 390 WP_272510767.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=780163 PNF30_RS04390 WP_003213123.1 888829..888969(+) (degQ) [Bacillus safensis strain SRCM125915]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=780163 PNF30_RS04390 WP_003213123.1 888829..888969(+) (degQ) [Bacillus safensis strain SRCM125915]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696