Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PNF29_RS09010 | Genome accession | NZ_CP116773 |
| Coordinates | 1704604..1704777 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis strain SRCM125727 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1699604..1709777
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PNF29_RS08965 (PNF29_08965) | comGE | 1699956..1700303 (+) | 348 | WP_017696195.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| PNF29_RS08970 (PNF29_08970) | comGF | 1700329..1700712 (+) | 384 | WP_017696196.1 | ComG operon protein ComGF | Machinery gene |
| PNF29_RS08975 (PNF29_08975) | comGG | 1700713..1701087 (+) | 375 | WP_017696197.1 | ComG operon protein ComGG | Machinery gene |
| PNF29_RS08980 (PNF29_08980) | spoIITA | 1701158..1701337 (+) | 180 | WP_014480252.1 | YqzE family protein | - |
| PNF29_RS08985 (PNF29_08985) | yqzG | 1701379..1701705 (-) | 327 | WP_026113671.1 | YqzG/YhdC family protein | - |
| PNF29_RS08990 (PNF29_08990) | tapA | 1701976..1702737 (+) | 762 | WP_029317916.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PNF29_RS08995 (PNF29_08995) | sipW | 1702721..1703293 (+) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| PNF29_RS09000 (PNF29_09000) | tasA | 1703357..1704142 (+) | 786 | WP_003230183.1 | biofilm matrix protein TasA | - |
| PNF29_RS09005 (PNF29_09005) | sinR | 1704235..1704570 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| PNF29_RS09010 (PNF29_09010) | sinI | 1704604..1704777 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| PNF29_RS09015 (PNF29_09015) | yqhG | 1704960..1705754 (-) | 795 | WP_017696202.1 | YqhG family protein | - |
| PNF29_RS09020 (PNF29_09020) | hepAA | 1705775..1707448 (-) | 1674 | WP_272516116.1 | DEAD/DEAH box helicase | - |
| PNF29_RS09025 (PNF29_09025) | gcvT | 1707889..1708977 (+) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=780111 PNF29_RS09010 WP_003230187.1 1704604..1704777(-) (sinI) [Bacillus subtilis strain SRCM125727]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=780111 PNF29_RS09010 WP_003230187.1 1704604..1704777(-) (sinI) [Bacillus subtilis strain SRCM125727]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |