Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PNF29_RS09010 Genome accession   NZ_CP116773
Coordinates   1704604..1704777 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM125727     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1699604..1709777
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PNF29_RS08965 (PNF29_08965) comGE 1699956..1700303 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  PNF29_RS08970 (PNF29_08970) comGF 1700329..1700712 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  PNF29_RS08975 (PNF29_08975) comGG 1700713..1701087 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  PNF29_RS08980 (PNF29_08980) spoIITA 1701158..1701337 (+) 180 WP_014480252.1 YqzE family protein -
  PNF29_RS08985 (PNF29_08985) yqzG 1701379..1701705 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  PNF29_RS08990 (PNF29_08990) tapA 1701976..1702737 (+) 762 WP_029317916.1 amyloid fiber anchoring/assembly protein TapA -
  PNF29_RS08995 (PNF29_08995) sipW 1702721..1703293 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PNF29_RS09000 (PNF29_09000) tasA 1703357..1704142 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  PNF29_RS09005 (PNF29_09005) sinR 1704235..1704570 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PNF29_RS09010 (PNF29_09010) sinI 1704604..1704777 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  PNF29_RS09015 (PNF29_09015) yqhG 1704960..1705754 (-) 795 WP_017696202.1 YqhG family protein -
  PNF29_RS09020 (PNF29_09020) hepAA 1705775..1707448 (-) 1674 WP_272516116.1 DEAD/DEAH box helicase -
  PNF29_RS09025 (PNF29_09025) gcvT 1707889..1708977 (+) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=780111 PNF29_RS09010 WP_003230187.1 1704604..1704777(-) (sinI) [Bacillus subtilis strain SRCM125727]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=780111 PNF29_RS09010 WP_003230187.1 1704604..1704777(-) (sinI) [Bacillus subtilis strain SRCM125727]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1