Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   PNF29_RS08975 Genome accession   NZ_CP116773
Coordinates   1700713..1701087 (+) Length   124 a.a.
NCBI ID   WP_017696197.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM125727     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1695713..1706087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PNF29_RS08935 (PNF29_08935) corA 1695783..1696736 (+) 954 WP_272516111.1 magnesium transporter CorA -
  PNF29_RS08940 (PNF29_08940) - 1696738..1696935 (+) 198 WP_272516202.1 CBS domain-containing protein -
  PNF29_RS08945 (PNF29_08945) comGA 1697147..1698217 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PNF29_RS08950 (PNF29_08950) comGB 1698204..1699241 (+) 1038 WP_017696193.1 competence type IV pilus assembly protein ComGB Machinery gene
  PNF29_RS08955 (PNF29_08955) comGC 1699255..1699551 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PNF29_RS08960 (PNF29_08960) comGD 1699541..1699972 (+) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  PNF29_RS08965 (PNF29_08965) comGE 1699956..1700303 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  PNF29_RS08970 (PNF29_08970) comGF 1700329..1700712 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  PNF29_RS08975 (PNF29_08975) comGG 1700713..1701087 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  PNF29_RS08980 (PNF29_08980) spoIITA 1701158..1701337 (+) 180 WP_014480252.1 YqzE family protein -
  PNF29_RS08985 (PNF29_08985) yqzG 1701379..1701705 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  PNF29_RS08990 (PNF29_08990) tapA 1701976..1702737 (+) 762 WP_029317916.1 amyloid fiber anchoring/assembly protein TapA -
  PNF29_RS08995 (PNF29_08995) sipW 1702721..1703293 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PNF29_RS09000 (PNF29_09000) tasA 1703357..1704142 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  PNF29_RS09005 (PNF29_09005) sinR 1704235..1704570 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PNF29_RS09010 (PNF29_09010) sinI 1704604..1704777 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  PNF29_RS09015 (PNF29_09015) yqhG 1704960..1705754 (-) 795 WP_017696202.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14526.75 Da        Isoelectric Point: 9.7778

>NTDB_id=780109 PNF29_RS08975 WP_017696197.1 1700713..1701087(+) (comGG) [Bacillus subtilis strain SRCM125727]
MYRTRGFIYPAVLFVSALVLLIVNFASAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=780109 PNF29_RS08975 WP_017696197.1 1700713..1701087(+) (comGG) [Bacillus subtilis strain SRCM125727]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTACTGTTAATCGTGAACTTTGCTTC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952