Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   PHA49_RS00705 Genome accession   NZ_CP116234
Coordinates   153930..154055 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain H390d     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 148930..159055
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PHA49_RS00680 (PHA49_00680) - 148994..151216 (+) 2223 WP_271330814.1 AAA family ATPase -
  PHA49_RS00685 (PHA49_00685) panD 151206..151562 (+) 357 WP_271330815.1 aspartate 1-decarboxylase -
  PHA49_RS00690 (PHA49_00690) - 151565..151858 (+) 294 WP_271330816.1 YbaB/EbfC family nucleoid-associated protein -
  PHA49_RS00695 (PHA49_00695) - 151858..152853 (+) 996 WP_271331139.1 PDZ domain-containing protein -
  PHA49_RS00700 (PHA49_00700) comB6 152859..153914 (+) 1056 WP_271330817.1 P-type conjugative transfer protein TrbL Machinery gene
  PHA49_RS00705 (PHA49_00705) comB7 153930..154055 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  PHA49_RS00710 (PHA49_00710) comB8 154052..154795 (+) 744 WP_000660533.1 type IV secretion system protein Machinery gene
  PHA49_RS00715 (PHA49_00715) comB9 154795..155757 (+) 963 WP_271330818.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  PHA49_RS00720 (PHA49_00720) comB10 155750..156886 (+) 1137 WP_271330819.1 DNA type IV secretion system protein ComB10 Machinery gene
  PHA49_RS00725 (PHA49_00725) - 156956..158368 (+) 1413 WP_271330820.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=776254 PHA49_RS00705 WP_001217874.1 153930..154055(+) (comB7) [Helicobacter pylori strain H390d]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=776254 PHA49_RS00705 WP_001217874.1 153930..154055(+) (comB7) [Helicobacter pylori strain H390d]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878