Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   PF996_RS13275 Genome accession   NZ_CP116014
Coordinates   2607843..2608220 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM124633     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2602843..2613220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF996_RS13235 (PF996_13235) - 2603340..2604134 (+) 795 WP_014418368.1 YqhG family protein -
  PF996_RS13240 (PF996_13240) sinI 2604311..2604484 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  PF996_RS13245 (PF996_13245) sinR 2604518..2604853 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PF996_RS13250 (PF996_13250) tasA 2604901..2605686 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  PF996_RS13255 (PF996_13255) sipW 2605751..2606335 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PF996_RS13260 (PF996_13260) tapA 2606307..2606978 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PF996_RS13265 (PF996_13265) - 2607237..2607566 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF996_RS13270 (PF996_13270) - 2607607..2607786 (-) 180 WP_003153093.1 YqzE family protein -
  PF996_RS13275 (PF996_13275) comGG 2607843..2608220 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF996_RS13280 (PF996_13280) comGF 2608221..2608616 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  PF996_RS13285 (PF996_13285) comGE 2608630..2608944 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  PF996_RS13290 (PF996_13290) comGD 2608928..2609365 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PF996_RS13295 (PF996_13295) comGC 2609355..2609663 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  PF996_RS13300 (PF996_13300) comGB 2609668..2610705 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  PF996_RS13305 (PF996_13305) comGA 2610692..2611762 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  PF996_RS13310 (PF996_13310) - 2611954..2612904 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=775268 PF996_RS13275 WP_017418138.1 2607843..2608220(-) (comGG) [Bacillus velezensis strain SRCM124633]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=775268 PF996_RS13275 WP_017418138.1 2607843..2608220(-) (comGG) [Bacillus velezensis strain SRCM124633]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512