Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PF996_RS13240 Genome accession   NZ_CP116014
Coordinates   2604311..2604484 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SRCM124633     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2599311..2609484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF996_RS13225 (PF996_13225) gcvT 2600124..2601224 (-) 1101 WP_271265647.1 glycine cleavage system aminomethyltransferase GcvT -
  PF996_RS13230 (PF996_13230) - 2601648..2603318 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  PF996_RS13235 (PF996_13235) - 2603340..2604134 (+) 795 WP_014418368.1 YqhG family protein -
  PF996_RS13240 (PF996_13240) sinI 2604311..2604484 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  PF996_RS13245 (PF996_13245) sinR 2604518..2604853 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PF996_RS13250 (PF996_13250) tasA 2604901..2605686 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  PF996_RS13255 (PF996_13255) sipW 2605751..2606335 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PF996_RS13260 (PF996_13260) tapA 2606307..2606978 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PF996_RS13265 (PF996_13265) - 2607237..2607566 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PF996_RS13270 (PF996_13270) - 2607607..2607786 (-) 180 WP_003153093.1 YqzE family protein -
  PF996_RS13275 (PF996_13275) comGG 2607843..2608220 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF996_RS13280 (PF996_13280) comGF 2608221..2608616 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  PF996_RS13285 (PF996_13285) comGE 2608630..2608944 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  PF996_RS13290 (PF996_13290) comGD 2608928..2609365 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=775266 PF996_RS13240 WP_014418369.1 2604311..2604484(+) (sinI) [Bacillus velezensis strain SRCM124633]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=775266 PF996_RS13240 WP_014418369.1 2604311..2604484(+) (sinI) [Bacillus velezensis strain SRCM124633]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719