Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | PF986_RS10455 | Genome accession | NZ_CP116013 |
| Coordinates | 2167912..2168052 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SRCM124349 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2162912..2173052
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF986_RS10430 (PF986_10430) | - | 2163208..2163591 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| PF986_RS10435 (PF986_10435) | comA | 2163613..2164257 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| PF986_RS10440 (PF986_10440) | comP | 2164338..2166647 (-) | 2310 | WP_260654593.1 | histidine kinase | Regulator |
| PF986_RS10445 (PF986_10445) | - | 2166667..2166843 (-) | 177 | WP_087634937.1 | competence pheromone ComX | - |
| PF986_RS10450 (PF986_10450) | comQ | 2166843..2167781 (-) | 939 | WP_271243340.1 | polyprenyl synthetase family protein | Regulator |
| PF986_RS10455 (PF986_10455) | degQ | 2167912..2168052 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| PF986_RS10460 (PF986_10460) | - | 2168517..2168858 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| PF986_RS10465 (PF986_10465) | - | 2168865..2170088 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| PF986_RS10470 (PF986_10470) | - | 2170218..2171684 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| PF986_RS10475 (PF986_10475) | - | 2171702..2172253 (-) | 552 | WP_123117419.1 | cysteine hydrolase family protein | - |
| PF986_RS10480 (PF986_10480) | - | 2172350..2172748 (-) | 399 | WP_065180454.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=775200 PF986_RS10455 WP_003152043.1 2167912..2168052(-) (degQ) [Bacillus velezensis strain SRCM124349]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=775200 PF986_RS10455 WP_003152043.1 2167912..2168052(-) (degQ) [Bacillus velezensis strain SRCM124349]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |