Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PF986_RS10455 Genome accession   NZ_CP116013
Coordinates   2167912..2168052 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM124349     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2162912..2173052
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF986_RS10430 (PF986_10430) - 2163208..2163591 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  PF986_RS10435 (PF986_10435) comA 2163613..2164257 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  PF986_RS10440 (PF986_10440) comP 2164338..2166647 (-) 2310 WP_260654593.1 histidine kinase Regulator
  PF986_RS10445 (PF986_10445) - 2166667..2166843 (-) 177 WP_087634937.1 competence pheromone ComX -
  PF986_RS10450 (PF986_10450) comQ 2166843..2167781 (-) 939 WP_271243340.1 polyprenyl synthetase family protein Regulator
  PF986_RS10455 (PF986_10455) degQ 2167912..2168052 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PF986_RS10460 (PF986_10460) - 2168517..2168858 (+) 342 WP_014418765.1 hypothetical protein -
  PF986_RS10465 (PF986_10465) - 2168865..2170088 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  PF986_RS10470 (PF986_10470) - 2170218..2171684 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  PF986_RS10475 (PF986_10475) - 2171702..2172253 (-) 552 WP_123117419.1 cysteine hydrolase family protein -
  PF986_RS10480 (PF986_10480) - 2172350..2172748 (-) 399 WP_065180454.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=775200 PF986_RS10455 WP_003152043.1 2167912..2168052(-) (degQ) [Bacillus velezensis strain SRCM124349]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=775200 PF986_RS10455 WP_003152043.1 2167912..2168052(-) (degQ) [Bacillus velezensis strain SRCM124349]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891