Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilV   Type   Machinery gene
Locus tag   PCP57_RS09165 Genome accession   NZ_CP115287
Coordinates   1984972..1985529 (-) Length   185 a.a.
NCBI ID   WP_003125211.1    Uniprot ID   A0A6A9K9C7
Organism   Pseudomonas aeruginosa strain F006     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1986132..2008571 1984972..1985529 flank 603


Gene organization within MGE regions


Location: 1984972..2008571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PCP57_RS09165 (PCP57_09175) pilV 1984972..1985529 (-) 558 WP_003125211.1 type 4a pilus minor pilin PilV Machinery gene
  PCP57_RS09170 (PCP57_09180) - 1985520..1986026 (-) 507 WP_003134935.1 GspH/FimT family pseudopilin -
  PCP57_RS09175 (PCP57_09185) - 1986132..1986641 (-) 510 WP_033976381.1 GspH/FimT family pseudopilin -
  PCP57_RS09180 (PCP57_09190) thiO 1986776..1987870 (+) 1095 WP_039028141.1 glycine oxidase ThiO -
  PCP57_RS09185 (PCP57_09195) pilR 1987916..1989253 (-) 1338 WP_003094694.1 two-component system response regulator PilR Regulator
  PCP57_RS09190 (PCP57_09200) pilS 1989268..1990860 (-) 1593 WP_039028118.1 two-component system sensor histidine kinase PilS Regulator
  PCP57_RS09195 (PCP57_09205) - 1990850..1991095 (-) 246 WP_003102591.1 PP0621 family protein -
  PCP57_RS09200 (PCP57_09210) - 1991252..1992277 (-) 1026 WP_033972916.1 outer membrane protein assembly factor BamD -
  PCP57_RS09205 (PCP57_09215) rluD 1992423..1993385 (+) 963 WP_033972915.1 23S rRNA pseudouridine(1911/1915/1917) synthase RluD -
  PCP57_RS09210 (PCP57_09220) pgeF 1993382..1994110 (+) 729 WP_058179501.1 peptidoglycan editing factor PgeF -
  PCP57_RS09215 (PCP57_09225) clpB 1994266..1996830 (+) 2565 WP_003094682.1 ATP-dependent chaperone ClpB -
  PCP57_RS09235 (PCP57_09245) - 1997500..1998011 (-) 512 Protein_1814 IS3 family transposase -
  PCP57_RS29245 - 1998814..1999056 (+) 243 Protein_1815 hypothetical protein -
  PCP57_RS09245 (PCP57_09255) - 1999415..1999627 (+) 213 WP_328994894.1 fimbrial protein -
  PCP57_RS09250 - 2000266..2000463 (+) 198 WP_071546846.1 hypothetical protein -
  PCP57_RS09255 (PCP57_09260) - 2000515..2001276 (-) 762 Protein_1818 IS3 family transposase -
  PCP57_RS09260 (PCP57_09265) - 2001268..2001567 (-) 300 Protein_1819 ESPR domain-containing protein -
  PCP57_RS09265 (PCP57_09270) - 2001583..2003220 (-) 1638 WP_400638505.1 ShlB/FhaC/HecB family hemolysin secretion/activation protein -
  PCP57_RS09270 (PCP57_09275) zapE 2003807..2004865 (+) 1059 WP_058018304.1 cell division protein ZapE -
  PCP57_RS09275 (PCP57_09280) - 2004904..2006211 (-) 1308 WP_328994898.1 NAD(P)/FAD-dependent oxidoreductase -
  PCP57_RS09280 (PCP57_09285) - 2006275..2006445 (-) 171 WP_003094672.1 DUF3094 family protein -
  PCP57_RS09285 (PCP57_09290) - 2006471..2006920 (-) 450 WP_033970456.1 MOSC domain-containing protein -
  PCP57_RS09290 (PCP57_09295) - 2006917..2007546 (-) 630 WP_003094668.1 DUF1780 domain-containing protein -
  PCP57_RS09295 (PCP57_09300) - 2007679..2008104 (+) 426 WP_033976385.1 GNAT family N-acetyltransferase -
  PCP57_RS09300 (PCP57_09305) - 2008101..2008571 (+) 471 WP_328994901.1 FAD/FMN-containing dehydrogenase -

Sequence

Protein


Download         Length: 185 a.a.        Molecular weight: 20087.19 Da        Isoelectric Point: 8.2171

>NTDB_id=771339 PCP57_RS09165 WP_003125211.1 1984972..1985529(-) (pilV) [Pseudomonas aeruginosa strain F006]
MLLKSRHRSLYQSGFSMIEVLVALLLISIGVLGMIAMQGKTIQYTADSVERNKAAMLGSNLLESMRASPKALYDVKDQMA
TQSDFFKAKGSAFPTAPSSCTPLPDAIKDRLGCWAEQVKNELPGAGDLLKSDYYICRSSKPGDCDGKGSMLEIRLAWRGK
QGACVNAADSSADTSLCYYTLRVEP

Nucleotide


Download         Length: 558 bp        

>NTDB_id=771339 PCP57_RS09165 WP_003125211.1 1984972..1985529(-) (pilV) [Pseudomonas aeruginosa strain F006]
ATGCTATTGAAATCGCGACACAGGTCGCTGTACCAATCCGGCTTCAGCATGATCGAAGTGCTGGTCGCCCTGCTGCTGAT
CAGCATCGGCGTGCTGGGCATGATCGCCATGCAGGGCAAGACCATCCAGTACACCGCCGACTCGGTCGAGCGCAACAAGG
CAGCCATGCTCGGCAGCAACCTGCTGGAAAGCATGCGGGCGAGCCCGAAGGCGCTGTACGACGTCAAGGACCAGATGGCC
ACGCAATCCGACTTCTTCAAGGCCAAGGGGTCGGCGTTCCCCACCGCGCCGTCCTCCTGTACGCCATTGCCCGACGCGAT
CAAGGACCGCCTGGGATGCTGGGCGGAACAGGTGAAGAACGAACTGCCAGGCGCTGGCGACCTGCTGAAGAGCGACTACT
ACATCTGCCGCAGCTCGAAGCCGGGCGACTGCGACGGCAAGGGCTCCATGCTGGAAATCCGCCTGGCCTGGCGCGGCAAG
CAAGGCGCCTGCGTCAACGCCGCCGACAGCAGCGCCGATACCTCCCTCTGCTACTACACCCTCAGGGTCGAGCCATGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(12-34)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6A9K9C7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Pseudomonas aeruginosa PAK

98.919

100

0.989