Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   O9T43_RS12815 Genome accession   NZ_CP115041
Coordinates   2548298..2548780 (-) Length   160 a.a.
NCBI ID   WP_003722552.1    Uniprot ID   A0A3T2EU60
Organism   Listeria monocytogenes strain MKELm2_2022     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2520809..2566410 2548298..2548780 within 0


Gene organization within MGE regions


Location: 2520809..2566410
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O9T43_RS12620 (O9T43_12620) - 2520809..2521012 (-) 204 WP_003731279.1 hypothetical protein -
  O9T43_RS12625 (O9T43_12625) - 2521009..2521242 (-) 234 WP_009924650.1 hypothetical protein -
  O9T43_RS12630 (O9T43_12630) - 2521542..2521775 (+) 234 WP_009924649.1 hypothetical protein -
  O9T43_RS12635 (O9T43_12635) acrIIA2 2521804..2522175 (+) 372 WP_003722517.1 anti-CRISPR protein AcrIIA2 -
  O9T43_RS12640 (O9T43_12640) acrIIA1 2522181..2522630 (+) 450 WP_031669445.1 anti-CRISPR protein AcrIIA1 -
  O9T43_RS12645 (O9T43_12645) - 2522655..2523152 (+) 498 WP_009926666.1 AP2 domain-containing protein -
  O9T43_RS12650 (O9T43_12650) - 2523229..2523780 (-) 552 WP_010989943.1 PBECR4 domain-containing protein -
  O9T43_RS12655 (O9T43_12655) - 2524274..2525119 (-) 846 WP_010989944.1 DUF5776 domain-containing protein -
  O9T43_RS12660 (O9T43_12660) - 2525119..2525400 (-) 282 WP_003722522.1 holin -
  O9T43_RS12665 (O9T43_12665) - 2525413..2525778 (-) 366 WP_003722523.1 Gp23 family protein -
  O9T43_RS12670 (O9T43_12670) - 2525806..2525964 (-) 159 WP_003722524.1 CD1375 family protein -
  O9T43_RS12675 (O9T43_12675) - 2525969..2526286 (-) 318 WP_003722525.1 hypothetical protein -
  O9T43_RS12680 (O9T43_12680) - 2526298..2527371 (-) 1074 WP_003722526.1 phage baseplate upper protein -
  O9T43_RS12685 (O9T43_12685) - 2527371..2528399 (-) 1029 WP_003722527.1 hypothetical protein -
  O9T43_RS12690 (O9T43_12690) - 2528400..2529425 (-) 1026 WP_003722528.1 phage tail protein -
  O9T43_RS12695 (O9T43_12695) - 2529434..2530252 (-) 819 WP_003722529.1 phage tail family protein -
  O9T43_RS12700 (O9T43_12700) - 2530254..2535617 (-) 5364 WP_055310958.1 tape measure protein -
  O9T43_RS12705 (O9T43_12705) - 2535628..2536233 (-) 606 WP_003722531.1 bacteriophage Gp15 family protein -
  O9T43_RS12710 (O9T43_12710) - 2536239..2536661 (-) 423 WP_003727791.1 phage tail assembly chaperone -
  O9T43_RS12715 (O9T43_12715) - 2536716..2537048 (-) 333 WP_003727790.1 Ig-like domain-containing protein -
  O9T43_RS12720 (O9T43_12720) - 2536978..2537412 (-) 435 WP_009925981.1 phage tail tube protein -
  O9T43_RS12725 (O9T43_12725) - 2537415..2537822 (-) 408 WP_003737937.1 minor capsid protein -
  O9T43_RS12730 (O9T43_12730) - 2537822..2538160 (-) 339 WP_029508830.1 minor capsid protein -
  O9T43_RS12735 (O9T43_12735) - 2538160..2538522 (-) 363 WP_055310957.1 VanZ family protein -
  O9T43_RS12740 (O9T43_12740) - 2538522..2538917 (-) 396 WP_009925044.1 hypothetical protein -
  O9T43_RS12745 (O9T43_12745) - 2538919..2539077 (-) 159 WP_009925045.1 HeH/LEM domain-containing protein -
  O9T43_RS12750 (O9T43_12750) - 2539077..2539976 (-) 900 WP_031645714.1 phage major capsid protein -
  O9T43_RS12755 (O9T43_12755) - 2540000..2540569 (-) 570 WP_009925047.1 phage scaffolding protein -
  O9T43_RS12760 (O9T43_12760) - 2540648..2541787 (-) 1140 WP_039381673.1 phage minor capsid protein -
  O9T43_RS12765 (O9T43_12765) - 2541788..2543557 (-) 1770 WP_009925050.1 phage portal protein -
  O9T43_RS12770 (O9T43_12770) - 2543570..2544901 (-) 1332 WP_269844379.1 PBSX family phage terminase large subunit -
  O9T43_RS12775 (O9T43_12775) - 2544870..2545664 (-) 795 WP_010989957.1 terminase small subunit -
  O9T43_RS12780 (O9T43_12780) - 2545710..2546249 (-) 540 WP_003734122.1 hypothetical protein -
  O9T43_RS12785 (O9T43_12785) - 2546615..2547049 (-) 435 WP_003735131.1 ArpU family phage packaging/lysis transcriptional regulator -
  O9T43_RS12790 (O9T43_12790) - 2547068..2547232 (-) 165 WP_003727776.1 hypothetical protein -
  O9T43_RS12795 (O9T43_12795) - 2547243..2547368 (-) 126 WP_009924216.1 hypothetical protein -
  O9T43_RS12800 (O9T43_12800) - 2547361..2547744 (-) 384 WP_009924217.1 DUF2481 family protein -
  O9T43_RS12805 (O9T43_12805) - 2547748..2548152 (-) 405 WP_010989958.1 DUF1064 domain-containing protein -
  O9T43_RS12810 (O9T43_12810) - 2548097..2548279 (-) 183 WP_009924219.1 hypothetical protein -
  O9T43_RS12815 (O9T43_12815) ssbA 2548298..2548780 (-) 483 WP_003722552.1 single-stranded DNA-binding protein Machinery gene
  O9T43_RS12820 (O9T43_12820) - 2548777..2548956 (-) 180 WP_003733878.1 hypothetical protein -
  O9T43_RS12825 (O9T43_12825) - 2549060..2549227 (-) 168 WP_003722554.1 hypothetical protein -
  O9T43_RS12830 (O9T43_12830) - 2549224..2549685 (-) 462 WP_003722555.1 hypothetical protein -
  O9T43_RS12835 (O9T43_12835) - 2549682..2550152 (-) 471 WP_003722556.1 pentapeptide repeat-containing protein -
  O9T43_RS12840 (O9T43_12840) - 2550149..2550592 (-) 444 WP_003722557.1 YopX family protein -
  O9T43_RS12845 (O9T43_12845) - 2550589..2550786 (-) 198 WP_003722558.1 hypothetical protein -
  O9T43_RS12850 (O9T43_12850) - 2550789..2551385 (-) 597 WP_003722559.1 DUF1642 domain-containing protein -
  O9T43_RS12855 (O9T43_12855) - 2551382..2552194 (-) 813 WP_003722560.1 DNA adenine methylase -
  O9T43_RS12860 (O9T43_12860) - 2552191..2553102 (-) 912 WP_009924222.1 DnaD domain-containing protein -
  O9T43_RS12865 (O9T43_12865) - 2553140..2554051 (-) 912 WP_009924223.1 RecT family recombinase -
  O9T43_RS12870 (O9T43_12870) - 2554044..2555555 (-) 1512 WP_055310956.1 AAA family ATPase -
  O9T43_RS12875 (O9T43_12875) - 2555652..2555780 (-) 129 WP_009924227.1 hypothetical protein -
  O9T43_RS12880 (O9T43_12880) - 2555859..2556047 (-) 189 WP_003722564.1 gp45 family putative tail fiber system protein -
  O9T43_RS12885 (O9T43_12885) - 2556155..2556391 (-) 237 WP_003731810.1 DUF771 domain-containing protein -
  O9T43_RS12890 (O9T43_12890) - 2556398..2556922 (-) 525 WP_009924228.1 hypothetical protein -
  O9T43_RS12895 (O9T43_12895) - 2557045..2557818 (-) 774 WP_009924229.1 Rha family transcriptional regulator -
  O9T43_RS12900 (O9T43_12900) - 2557829..2558017 (-) 189 WP_009924230.1 hypothetical protein -
  O9T43_RS12905 (O9T43_12905) - 2558050..2558253 (-) 204 WP_009924231.1 helix-turn-helix transcriptional regulator -
  O9T43_RS12910 (O9T43_12910) - 2558422..2558898 (+) 477 WP_009924232.1 helix-turn-helix domain-containing protein -
  O9T43_RS12915 (O9T43_12915) - 2559055..2559222 (+) 168 WP_009924233.1 hypothetical protein -
  O9T43_RS12920 (O9T43_12920) - 2559277..2559927 (+) 651 WP_009924234.1 hypothetical protein -
  O9T43_RS12925 (O9T43_12925) - 2559992..2561122 (+) 1131 WP_009924235.1 site-specific integrase -
  O9T43_RS12935 (O9T43_12935) - 2561398..2562834 (-) 1437 WP_039387421.1 polysaccharide monooxygenase -
  O9T43_RS12940 (O9T43_12940) clpP 2562991..2563587 (+) 597 WP_003722600.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
  O9T43_RS12945 (O9T43_12945) - 2563635..2565026 (-) 1392 WP_003732491.1 amino acid permease -
  O9T43_RS12950 (O9T43_12950) inlP 2565244..2566410 (+) 1167 WP_039387423.1 class 3 internalin InlP -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17837.65 Da        Isoelectric Point: 4.9909

>NTDB_id=768058 O9T43_RS12815 WP_003722552.1 2548298..2548780(-) (ssbA) [Listeria monocytogenes strain MKELm2_2022]
MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=768058 O9T43_RS12815 WP_003722552.1 2548298..2548780(-) (ssbA) [Listeria monocytogenes strain MKELm2_2022]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCAGTAAATCGTACATTCACTAATCAAAACGGAGAACGAGAAGCAGATTTCATTAATTGTGTTGTTT
GGCGCAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAACGACGGTAAACGTGTTTTCGTTACTGAGGTAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
TAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATGAAGATGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A3T2EU60

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.116

100

0.7
  ssb Latilactobacillus sakei subsp. sakei 23K

55.294

100

0.587
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

66.25

0.419