Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrR   Type   Regulator
Locus tag   O6R09_RS05490 Genome accession   NZ_CP114883
Coordinates   1059341..1059775 (-) Length   144 a.a.
NCBI ID   WP_235280696.1    Uniprot ID   -
Organism   Streptococcus alactolyticus strain LGM     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1053982..1086659 1059341..1059775 within 0


Gene organization within MGE regions


Location: 1053982..1086659
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O6R09_RS05465 (O6R09_05465) - 1053982..1054902 (-) 921 WP_269725871.1 glycine betaine ABC transporter substrate-binding protein -
  O6R09_RS05470 (O6R09_05470) - 1054892..1055527 (-) 636 Protein_1018 ABC transporter permease -
  O6R09_RS05475 (O6R09_05475) - 1055605..1055757 (+) 153 WP_154454618.1 hypothetical protein -
  O6R09_RS05480 (O6R09_05480) rcrQ 1055754..1057526 (-) 1773 WP_154454617.1 ABC transporter ATP-binding protein Regulator
  O6R09_RS05485 (O6R09_05485) rcrP 1057516..1059330 (-) 1815 WP_154454616.1 ABC transporter ATP-binding protein Regulator
  O6R09_RS05490 (O6R09_05490) rcrR 1059341..1059775 (-) 435 WP_235280696.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  O6R09_RS05495 (O6R09_05495) - 1059920..1060330 (-) 411 WP_154454614.1 peptide deformylase -
  O6R09_RS05500 (O6R09_05500) gdhA 1060420..1061769 (-) 1350 WP_154454613.1 NADP-specific glutamate dehydrogenase -
  O6R09_RS05505 (O6R09_05505) - 1062005..1062502 (+) 498 WP_154454612.1 HdeD family acid-resistance protein -
  O6R09_RS05510 (O6R09_05510) queF 1062551..1063041 (-) 491 Protein_1026 preQ(1) synthase -
  O6R09_RS05515 (O6R09_05515) queE 1063054..1063767 (-) 714 WP_154454611.1 7-carboxy-7-deazaguanine synthase QueE -
  O6R09_RS05520 (O6R09_05520) queD 1063733..1064206 (-) 474 WP_154454610.1 6-carboxytetrahydropterin synthase QueD -
  O6R09_RS05525 (O6R09_05525) queC 1064206..1064676 (-) 471 Protein_1029 7-cyano-7-deazaguanine synthase QueC -
  O6R09_RS05530 (O6R09_05530) - 1064670..1066094 (-) 1425 Protein_1030 VirB4-like conjugal transfer ATPase, CD1110 family -
  O6R09_RS05535 (O6R09_05535) - 1066215..1066697 (-) 483 WP_154454609.1 hypothetical protein -
  O6R09_RS05540 (O6R09_05540) - 1066709..1067461 (-) 753 WP_154454630.1 hypothetical protein -
  O6R09_RS05545 (O6R09_05545) - 1067535..1068075 (-) 541 Protein_1033 hypothetical protein -
  O6R09_RS05550 (O6R09_05550) - 1068156..1068383 (-) 228 WP_043037322.1 hypothetical protein -
  O6R09_RS05555 (O6R09_05555) - 1068656..1072072 (-) 3417 WP_154454608.1 GBS Bsp-like repeat-containing protein -
  O6R09_RS05560 (O6R09_05560) - 1072270..1074057 (-) 1788 WP_269725484.1 LPXTG cell wall anchor domain-containing protein -
  O6R09_RS05565 (O6R09_05565) - 1074069..1074455 (-) 387 WP_154454607.1 hypothetical protein -
  O6R09_RS05570 (O6R09_05570) - 1074568..1074762 (-) 195 Protein_1038 7-cyano-7-deazaguanine synthase -
  O6R09_RS05575 (O6R09_05575) - 1074947..1076716 (-) 1770 WP_154454606.1 ABC transporter ATP-binding protein -
  O6R09_RS05580 (O6R09_05580) - 1076719..1078458 (-) 1740 WP_154454605.1 ABC transporter ATP-binding protein -
  O6R09_RS05585 (O6R09_05585) - 1078523..1080394 (-) 1872 WP_235280699.1 ABC-F family ATP-binding cassette domain-containing protein -
  O6R09_RS05590 (O6R09_05590) - 1080391..1081596 (-) 1206 WP_269725485.1 CCA tRNA nucleotidyltransferase -
  O6R09_RS05595 (O6R09_05595) dapB 1081593..1082360 (-) 768 WP_235280700.1 4-hydroxy-tetrahydrodipicolinate reductase -
  O6R09_RS05600 (O6R09_05600) - 1082389..1083234 (-) 846 WP_154454601.1 DegV family protein -
  O6R09_RS05605 (O6R09_05605) - 1083234..1083614 (-) 381 WP_154454600.1 DUF1149 family protein -
  O6R09_RS05610 (O6R09_05610) - 1083714..1084394 (-) 681 WP_269725486.1 TMEM175 family protein -
  O6R09_RS05615 (O6R09_05615) - 1084465..1085001 (-) 537 WP_154454598.1 GNAT family N-acetyltransferase -
  O6R09_RS05620 (O6R09_05620) - 1085994..1086659 (-) 666 WP_235280703.1 glucosaminidase domain-containing protein -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 16702.54 Da        Isoelectric Point: 10.3555

>NTDB_id=767338 O6R09_RS05490 WP_235280696.1 1059341..1059775(-) (rcrR) [Streptococcus alactolyticus strain LGM]
MRPKDPFSQFRDFINLMENRVNHLAAVYGIEKLAGPQGFAVMYLCEDKGKEIFIKDIEKRLNISKSVTSNLIKRMEKNGF
IQVIPSKVDKRYKQVVLTELGESKAKAIKAFHDEMHDQVLKGISREDLRTSFRVFKQALKNLEK

Nucleotide


Download         Length: 435 bp        

>NTDB_id=767338 O6R09_RS05490 WP_235280696.1 1059341..1059775(-) (rcrR) [Streptococcus alactolyticus strain LGM]
ATGCGCCCAAAAGATCCATTTTCACAATTTAGGGATTTTATTAATTTGATGGAAAATCGTGTCAATCATCTTGCTGCGGT
GTACGGAATTGAAAAACTAGCTGGTCCACAAGGATTTGCGGTGATGTATCTTTGTGAGGATAAAGGAAAAGAAATCTTTA
TCAAAGACATTGAAAAGCGGTTAAACATTTCCAAATCAGTAACGAGTAACTTGATTAAACGTATGGAAAAAAATGGTTTT
ATCCAAGTGATTCCATCAAAAGTGGATAAGCGCTACAAACAAGTTGTTTTAACAGAATTAGGTGAATCAAAAGCGAAGGC
TATCAAGGCATTTCACGATGAAATGCATGACCAAGTGTTAAAAGGGATTAGCCGAGAGGATTTGAGAACCTCTTTTCGCG
TCTTTAAACAAGCTTTAAAAAATTTAGAAAAATAA

Domains


Predicted by InterproScan.

(39-91)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

58.865

97.917

0.576