Detailed information
Overview
| Name | rcrR | Type | Regulator |
| Locus tag | SMU_RS04250 | Genome accession | NC_004350 |
| Coordinates | 874590..875024 (+) | Length | 144 a.a. |
| NCBI ID | WP_002263292.1 | Uniprot ID | Q8DUK6 |
| Organism | Streptococcus mutans UA159 | ||
| Function | regulate competence Competence regulation |
||
Function
Mutations in the RcrR binding site impacted expression from the rcrR promoter in vivo and elicited changes in transformation efficiency, competence gene expression, and growth inhibition by competence-stimulating peptide; even when the changes in rcrRPQ transcription were minor. An additional mechanistic linkage of RcrR with competence and (p)ppGpp metabolism was identified by showing that the rRcrR protein could bind to the promoter regions of comX, comYA and relP, although the binding was not as efficient as to the rcrRPQ promoter under the conditions tested.
Genomic Context
Location: 869590..880024
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS04220 (SMU.913) | gdhA | 869772..871121 (+) | 1350 | WP_002263849.1 | NADP-specific glutamate dehydrogenase | - |
| SMU_RS04225 (SMU.914c) | - | 871233..871616 (-) | 384 | WP_002263287.1 | DUF3021 family protein | - |
| SMU_RS04230 (SMU.915c) | queF | 871725..872213 (-) | 489 | WP_002263288.1 | preQ(1) synthase | - |
| SMU_RS04235 (SMU.916c) | queE | 872226..872942 (-) | 717 | WP_002263289.1 | 7-carboxy-7-deazaguanine synthase QueE | - |
| SMU_RS04240 (SMU.917c) | queD | 872939..873385 (-) | 447 | WP_002263290.1 | 6-carboxytetrahydropterin synthase QueD | - |
| SMU_RS04245 (SMU.919c) | queC | 873385..874038 (-) | 654 | WP_002263291.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| SMU_RS04250 (SMU.921) | rcrR | 874590..875024 (+) | 435 | WP_002263292.1 | MarR family winged helix-turn-helix transcriptional regulator | Regulator |
| SMU_RS04255 (SMU.922) | rcrP | 875028..876830 (+) | 1803 | WP_002263293.1 | ABC transporter ATP-binding protein | Regulator |
| SMU_RS04260 (SMU.923) | rcrQ | 876820..878574 (+) | 1755 | WP_002263294.1 | ABC transporter ATP-binding protein | Regulator |
| SMU_RS04265 (SMU.924) | tpx | 878771..879256 (+) | 486 | WP_002263295.1 | thiol peroxidase | - |
| SMU_RS04270 (SMU.925) | - | 879393..879863 (+) | 471 | WP_002267997.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16720.58 Da Isoelectric Point: 10.5126
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE
Nucleotide
Download Length: 435 bp
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Robert C Shields et al. (2020) Peptides encoded in the Streptococcus mutans RcrRPQ operon are essential for thermotolerance. Microbiology (Reading, England) 166(3):306-317. [PMID: 31935187] |
| [2] | Kinda Seaton et al. (2015) Regulation of competence and gene expression in Streptococcus mutans by the RcrR transcriptional regulator. Molecular Oral Microbiology 30(2):147-159. [PMID: 25146832] |
| [3] | Robert C Shields et al. (2015) Conserved and divergent functions of RcrRPQ in Streptococcus gordonii and S. mutans. FEMS Microbiology Letters 362(16):fnv119. [PMID: 26229070] |
| [4] | Sang-Joon Ahn et al. (2014) Discovery of novel peptides regulating competence development in Streptococcus mutans. Journal of Bacteriology 196(21):3735-45. [PMID: 25135217] |
| [5] | Kinda Seaton et al. (2011) A transcriptional regulator and ABC transporters link stress tolerance, (p)ppGpp, and genetic competence in Streptococcus mutans. Journal of Bacteriology 193(4):862-74. [PMID: 21148727] |