Detailed information    

experimental Experimentally validated

Overview


Name   rcrR   Type   Regulator
Locus tag   SMU_RS04250 Genome accession   NC_004350
Coordinates   874590..875024 (+) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   Q8DUK6
Organism   Streptococcus mutans UA159     
Function   regulate competence   
Competence regulation

Function


Mutations in the RcrR binding site impacted expression from the rcrR promoter in vivo and elicited changes in transformation efficiency, competence gene expression, and growth inhibition by competence-stimulating peptide; even when the changes in rcrRPQ transcription were minor. An additional mechanistic linkage of RcrR with competence and (p)ppGpp metabolism was identified by showing that the rRcrR protein could bind to the promoter regions of comX, comYA and relP, although the binding was not as efficient as to the rcrRPQ promoter under the conditions tested.


Genomic Context


Location: 869590..880024
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMU_RS04220 (SMU.913) gdhA 869772..871121 (+) 1350 WP_002263849.1 NADP-specific glutamate dehydrogenase -
  SMU_RS04225 (SMU.914c) - 871233..871616 (-) 384 WP_002263287.1 DUF3021 family protein -
  SMU_RS04230 (SMU.915c) queF 871725..872213 (-) 489 WP_002263288.1 preQ(1) synthase -
  SMU_RS04235 (SMU.916c) queE 872226..872942 (-) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  SMU_RS04240 (SMU.917c) queD 872939..873385 (-) 447 WP_002263290.1 6-carboxytetrahydropterin synthase QueD -
  SMU_RS04245 (SMU.919c) queC 873385..874038 (-) 654 WP_002263291.1 7-cyano-7-deazaguanine synthase QueC -
  SMU_RS04250 (SMU.921) rcrR 874590..875024 (+) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  SMU_RS04255 (SMU.922) rcrP 875028..876830 (+) 1803 WP_002263293.1 ABC transporter ATP-binding protein Regulator
  SMU_RS04260 (SMU.923) rcrQ 876820..878574 (+) 1755 WP_002263294.1 ABC transporter ATP-binding protein Regulator
  SMU_RS04265 (SMU.924) tpx 878771..879256 (+) 486 WP_002263295.1 thiol peroxidase -
  SMU_RS04270 (SMU.925) - 879393..879863 (+) 471 WP_002267997.1 hypothetical protein -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=368 SMU_RS04250 WP_002263292.1 874590..875024(+) (rcrR) [Streptococcus mutans UA159]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=368 SMU_RS04250 WP_002263292.1 874590..875024(+) (rcrR) [Streptococcus mutans UA159]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains


Predicted by InterProScan.

(31-89)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DUK6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Robert C Shields et al. (2020) Peptides encoded in the Streptococcus mutans RcrRPQ operon are essential for thermotolerance. Microbiology (Reading, England) 166(3):306-317. [PMID: 31935187]
[2] Kinda Seaton et al. (2015) Regulation of competence and gene expression in Streptococcus mutans by the RcrR transcriptional regulator. Molecular Oral Microbiology 30(2):147-159. [PMID: 25146832]
[3] Robert C Shields et al. (2015) Conserved and divergent functions of RcrRPQ in Streptococcus gordonii and S. mutans. FEMS Microbiology Letters 362(16):fnv119. [PMID: 26229070]
[4] Sang-Joon Ahn et al. (2014) Discovery of novel peptides regulating competence development in Streptococcus mutans. Journal of Bacteriology 196(21):3735-45. [PMID: 25135217]
[5] Kinda Seaton et al. (2011) A transcriptional regulator and ABC transporters link stress tolerance, (p)ppGpp, and genetic competence in Streptococcus mutans. Journal of Bacteriology 193(4):862-74. [PMID: 21148727]