Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   O0R49_RS15970 Genome accession   NZ_CP114177
Coordinates   3022237..3022377 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain PLA 1006     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3017237..3027377
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O0R49_RS15945 (O0R49_15945) - 3017571..3017960 (-) 390 WP_048237324.1 hotdog fold thioesterase -
  O0R49_RS15950 (O0R49_15950) comA 3017984..3018625 (-) 642 WP_048237325.1 response regulator transcription factor Regulator
  O0R49_RS15955 (O0R49_15955) comP 3018706..3020997 (-) 2292 WP_269195572.1 ATP-binding protein Regulator
  O0R49_RS15960 (O0R49_15960) comX 3021011..3021184 (-) 174 WP_024425944.1 competence pheromone ComX -
  O0R49_RS15965 (O0R49_15965) - 3021162..3022085 (-) 924 WP_269195573.1 polyprenyl synthetase family protein -
  O0R49_RS15970 (O0R49_15970) degQ 3022237..3022377 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  O0R49_RS15975 (O0R49_15975) - 3022883..3023239 (+) 357 WP_269195574.1 inner spore coat protein -
  O0R49_RS15980 (O0R49_15980) - 3023273..3024499 (-) 1227 WP_048237328.1 EAL and HDOD domain-containing protein -
  O0R49_RS15985 (O0R49_15985) - 3024637..3026109 (-) 1473 WP_048237329.1 nicotinate phosphoribosyltransferase -
  O0R49_RS15990 (O0R49_15990) - 3026127..3026678 (-) 552 WP_048237330.1 cysteine hydrolase family protein -
  O0R49_RS15995 (O0R49_15995) - 3026739..3027146 (-) 408 WP_098677609.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=764729 O0R49_RS15970 WP_003213123.1 3022237..3022377(-) (degQ) [Bacillus safensis strain PLA 1006]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=764729 O0R49_RS15970 WP_003213123.1 3022237..3022377(-) (degQ) [Bacillus safensis strain PLA 1006]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696