Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   O0R52_RS16450 Genome accession   NZ_CP114066
Coordinates   3211855..3211995 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain B13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3206855..3216995
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O0R52_RS16425 (O0R52_16425) - 3207208..3207588 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  O0R52_RS16430 (O0R52_16430) comA 3207606..3208250 (-) 645 WP_269107368.1 two-component system response regulator ComA Regulator
  O0R52_RS16435 (O0R52_16435) comP 3208331..3210634 (-) 2304 WP_269107369.1 histidine kinase Regulator
  O0R52_RS16440 (O0R52_16440) comX 3210648..3210821 (-) 174 WP_127696529.1 competence pheromone ComX -
  O0R52_RS16445 (O0R52_16445) - 3210790..3211647 (-) 858 WP_164848141.1 polyprenyl synthetase family protein -
  O0R52_RS16450 (O0R52_16450) degQ 3211855..3211995 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  O0R52_RS16455 (O0R52_16455) - 3212456..3212824 (+) 369 WP_044158947.1 hypothetical protein -
  O0R52_RS16460 (O0R52_16460) - 3212800..3214029 (-) 1230 WP_044158949.1 EAL and HDOD domain-containing protein -
  O0R52_RS16465 (O0R52_16465) - 3214165..3215634 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  O0R52_RS16470 (O0R52_16470) - 3215650..3216201 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  O0R52_RS16475 (O0R52_16475) - 3216298..3216696 (-) 399 WP_044158951.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=764412 O0R52_RS16450 WP_024122683.1 3211855..3211995(-) (degQ) [Bacillus halotolerans strain B13]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=764412 O0R52_RS16450 WP_024122683.1 3211855..3211995(-) (degQ) [Bacillus halotolerans strain B13]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978