Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   OVA33_RS09215 Genome accession   NZ_CP113515
Coordinates   1805252..1805422 (+) Length   56 a.a.
NCBI ID   WP_025650218.1    Uniprot ID   -
Organism   Bacillus sp. KICET-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 1800252..1810422
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OVA33_RS09190 (OVA33_09195) - 1800400..1801866 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  OVA33_RS09195 (OVA33_09200) - 1801996..1803219 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  OVA33_RS09200 (OVA33_09205) - 1803226..1803567 (-) 342 WP_014418765.1 hypothetical protein -
  OVA33_RS09205 (OVA33_09210) degQ 1804032..1804172 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  OVA33_RS09210 (OVA33_09215) comQ 1804303..1805289 (+) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  OVA33_RS09215 (OVA33_09220) comX 1805252..1805422 (+) 171 WP_025650218.1 competence pheromone ComX Regulator
  OVA33_RS09220 (OVA33_09225) comP 1805442..1807745 (+) 2304 WP_025650219.1 histidine kinase Regulator
  OVA33_RS09225 (OVA33_09230) comA 1807826..1808470 (+) 645 WP_071181952.1 response regulator transcription factor Regulator
  OVA33_RS09230 (OVA33_09235) - 1808492..1808875 (+) 384 WP_065180456.1 hotdog fold thioesterase -
  OVA33_RS09235 (OVA33_09240) mnhG 1808915..1809289 (-) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  OVA33_RS09240 (OVA33_09245) - 1809273..1809557 (-) 285 WP_012118311.1 Na(+)/H(+) antiporter subunit F1 -
  OVA33_RS09245 (OVA33_09250) - 1809557..1810033 (-) 477 WP_017419419.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 56 a.a.        Molecular weight: 6590.54 Da        Isoelectric Point: 4.8018

>NTDB_id=762520 OVA33_RS09215 WP_025650218.1 1805252..1805422(+) (comX) [Bacillus sp. KICET-1]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGSDNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=762520 OVA33_RS09215 WP_025650218.1 1805252..1805422(+) (comX) [Bacillus sp. KICET-1]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGTAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTTCGGACAATAAAAAATGGG
ATAATGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5