Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | OVA33_RS09205 | Genome accession | NZ_CP113515 |
| Coordinates | 1804032..1804172 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus sp. KICET-1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1799032..1809172
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OVA33_RS09180 (OVA33_09185) | - | 1799336..1799734 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| OVA33_RS09185 (OVA33_09190) | - | 1799831..1800382 (+) | 552 | WP_025853916.1 | isochorismatase family cysteine hydrolase | - |
| OVA33_RS09190 (OVA33_09195) | - | 1800400..1801866 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| OVA33_RS09195 (OVA33_09200) | - | 1801996..1803219 (+) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| OVA33_RS09200 (OVA33_09205) | - | 1803226..1803567 (-) | 342 | WP_014418765.1 | hypothetical protein | - |
| OVA33_RS09205 (OVA33_09210) | degQ | 1804032..1804172 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| OVA33_RS09210 (OVA33_09215) | comQ | 1804303..1805289 (+) | 987 | WP_269321599.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| OVA33_RS09215 (OVA33_09220) | comX | 1805252..1805422 (+) | 171 | WP_025650218.1 | competence pheromone ComX | Regulator |
| OVA33_RS09220 (OVA33_09225) | comP | 1805442..1807745 (+) | 2304 | WP_025650219.1 | histidine kinase | Regulator |
| OVA33_RS09225 (OVA33_09230) | comA | 1807826..1808470 (+) | 645 | WP_071181952.1 | response regulator transcription factor | Regulator |
| OVA33_RS09230 (OVA33_09235) | - | 1808492..1808875 (+) | 384 | WP_065180456.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=762518 OVA33_RS09205 WP_003152043.1 1804032..1804172(+) (degQ) [Bacillus sp. KICET-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=762518 OVA33_RS09205 WP_003152043.1 1804032..1804172(+) (degQ) [Bacillus sp. KICET-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |