Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   OTU47_RS11450 Genome accession   NZ_CP113115
Coordinates   2188331..2188480 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain NP2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 2189347..2195086 2188331..2188480 flank 867


Gene organization within MGE regions


Location: 2188331..2195086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTU47_RS11450 (OTU47_11450) cipB 2188331..2188480 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  OTU47_RS11455 (OTU47_11455) blpN 2188724..2188927 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  OTU47_RS11460 (OTU47_11460) blpM 2188943..2189197 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  OTU47_RS11465 (OTU47_11465) - 2189347..2190152 (-) 806 Protein_2227 IS5 family transposase -
  OTU47_RS11470 (OTU47_11470) - 2190355..2190759 (-) 405 WP_000846944.1 hypothetical protein -
  OTU47_RS11475 (OTU47_11475) - 2190756..2190920 (-) 165 WP_000727118.1 hypothetical protein -
  OTU47_RS11480 (OTU47_11480) - 2191219..2191338 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OTU47_RS11485 (OTU47_11485) blpU 2191341..2191571 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  OTU47_RS11490 (OTU47_11490) blpJ 2191640..2191909 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  OTU47_RS11495 (OTU47_11495) blpI 2192376..2192573 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  OTU47_RS12060 comA/nlmT 2192887..2193474 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  OTU47_RS12065 comA/nlmT 2193419..2193880 (+) 462 WP_309543754.1 ABC transporter transmembrane domain-containing protein Regulator
  OTU47_RS11505 (OTU47_11505) - 2194133..2195086 (+) 954 WP_001155321.1 IS30-like element ISSpn8 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=760460 OTU47_RS11450 WP_001818346.1 2188331..2188480(-) (cipB) [Streptococcus pneumoniae strain NP2]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=760460 OTU47_RS11450 WP_001818346.1 2188331..2188480(-) (cipB) [Streptococcus pneumoniae strain NP2]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51