Detailed information    

insolico Bioinformatically predicted

Overview


Name   ccrB   Type   Machinery gene
Locus tag   OS078_RS03390 Genome accession   NZ_CP113015
Coordinates   647431..649056 (-) Length   541 a.a.
NCBI ID   WP_031926267.1    Uniprot ID   -
Organism   Staphylococcus aureus strain Zed     
Function   promote SCCmec transfer (predicted from homology)   
Homologous recombination

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
SCCmec 647431..718471 647431..649056 within 0


Gene organization within MGE regions


Location: 647431..718471
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OS078_RS03390 ccrB 647431..649056 (-) 1626 WP_031926267.1 cassette chromosome recombinase CcrB Machinery gene
  OS078_RS03395 ccrA 649078..650427 (-) 1350 WP_031926268.1 cassette chromosome recombinase CcrA Machinery gene
  OS078_RS03400 cch1 650615..652385 (-) 1771 Protein_637 cassette chromosome replicative helicase -
  OS078_RS03405 ssb 652385..652681 (-) 297 WP_000220590.1 cassette chromosome ssDNA-binding protein -
  OS078_RS03410 - 652855..654369 (-) 1515 WP_037541412.1 hypothetical protein -
  OS078_RS03415 - 654514..655218 (+) 705 WP_016170663.1 FRG domain-containing protein -
  OS078_RS03420 tirS 655242..656084 (+) 843 WP_000114516.1 NAD(+) hydrolase TirS -
  OS078_RS03425 - 656558..656836 (+) 279 WP_001837210.1 hypothetical protein -
  OS078_RS03430 - 656946..657104 (+) 159 WP_023604766.1 hypothetical protein -
  OS078_RS03435 - 657422..658061 (+) 640 Protein_644 fusidic acid resistance EF-G-binding protein FusC -
  OS078_RS03440 - 658748..659377 (+) 630 WP_001053440.1 hypothetical protein -
  OS078_RS03445 - 660056..660484 (-) 429 WP_001011132.1 VOC family protein -
  OS078_RS03450 - 660564..661494 (+) 931 Protein_647 helix-turn-helix transcriptional regulator -
  OS078_RS03455 - 661909..662160 (+) 252 WP_001823322.1 hypothetical protein -
  OS078_RS03460 - 662358..663221 (+) 864 WP_000680579.1 LEM-3-like GIY-YIG domain-containing protein -
  OS078_RS03465 - 663329..664803 (+) 1475 Protein_650 DUF6038 family protein -
  OS078_RS03470 - 665030..666130 (+) 1101 WP_000449985.1 DNA polymerase -
  OS078_RS03475 - 666123..666494 (+) 372 WP_001058157.1 hypothetical protein -
  OS078_RS03480 - 666491..668134 (+) 1644 WP_267789990.1 DUF5906 domain-containing protein -
  OS078_RS03485 ccrC 668359..670044 (+) 1686 WP_000676600.1 cassette chromosome recombinase CcrC -
  OS078_RS03490 tnpA 670092..670577 (+) 486 WP_000093392.1 IS200/IS605 family transposase -
  OS078_RS03495 - 670869..671207 (+) 339 WP_000175892.1 SAUGI family uracil-DNA glycosylase inhibitor -
  OS078_RS03500 - 671301..671612 (+) 312 WP_001166716.1 DUF960 family protein -
  OS078_RS03505 - 671628..672134 (+) 507 WP_000848380.1 DUF1643 domain-containing protein -
  OS078_RS03510 - 672155..672472 (+) 318 WP_023180038.1 JAB domain-containing protein -
  OS078_RS03515 - 672591..673676 (+) 1086 WP_000868132.1 tyrosine-type recombinase/integrase -
  OS078_RS03520 - 673673..675565 (+) 1893 Protein_661 site-specific integrase -
  OS078_RS03525 - 675572..675949 (+) 378 WP_000361059.1 DUF6262 family protein -
  OS078_RS03530 - 676100..676882 (+) 783 WP_000067268.1 aminoglycoside nucleotidyltransferase ANT(9)-Ia -
  OS078_RS03535 erm(A) 677008..677739 (-) 732 WP_001072201.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A) -
  OS078_RS15820 - 677797..677853 (-) 57 WP_418896071.1 erythromycin resistance leader peptide -
  OS078_RS03540 - 678245..678907 (+) 663 WP_001092058.1 class I SAM-dependent methyltransferase -
  OS078_RS03545 - 679139..679285 (+) 147 Protein_667 JAB domain-containing protein -
  OS078_RS03550 - 679455..680327 (+) 873 WP_000373151.1 HTH domain-containing protein -
  OS078_RS03555 - 680384..680674 (+) 291 WP_000065262.1 hypothetical protein -
  OS078_RS03560 - 680690..681178 (+) 489 WP_000397419.1 hypothetical protein -
  OS078_RS03565 - 681313..681840 (+) 528 WP_000717928.1 hypothetical protein -
  OS078_RS03570 - 681903..682319 (+) 417 WP_000941331.1 hypothetical protein -
  OS078_RS03575 - 682608..682772 (+) 165 WP_001803222.1 hypothetical protein -
  OS078_RS03580 - 682786..683007 (+) 222 WP_001070883.1 hypothetical protein -
  OS078_RS03585 - 683157..683723 (+) 567 WP_000759939.1 PepSY domain-containing protein -
  OS078_RS03590 - 683803..686016 (-) 2214 Protein_676 type I restriction endonuclease subunit R -
  OS078_RS03595 - 686078..686752 (-) 675 WP_001105999.1 IS6-like element IS257 family transposase -
  OS078_RS03600 - 687035..688381 (+) 1347 WP_064221817.1 dihydrolipoyl dehydrogenase family protein -
  OS078_RS03605 merR 688681..689088 (+) 408 WP_000425271.1 Hg(II)-responsive transcriptional regulator MerR -
  OS078_RS03610 - 689105..689458 (+) 354 WP_000746201.1 TlpA family protein disulfide reductase -
  OS078_RS03615 - 689455..690135 (+) 681 WP_000010352.1 cytochrome c biogenesis CcdA family protein -
  OS078_RS03620 merT 690223..690609 (+) 387 WP_001794630.1 mercuric transport protein MerT -
  OS078_RS03625 merA 690667..692310 (+) 1644 WP_000193219.1 mercury(II) reductase -
  OS078_RS03630 merB 692392..693042 (+) 651 WP_000790333.1 organomercurial lyase MerB -
  OS078_RS03635 - 693237..693752 (-) 516 WP_000377078.1 hypothetical protein -
  OS078_RS03640 - 693871..694545 (-) 675 WP_001105988.1 IS6-like element IS257 family transposase -
  OS078_RS03645 - 694581..694970 (+) 390 WP_020444595.1 hydroxymethylglutaryl-CoA synthase -
  OS078_RS03650 - 696047..696790 (+) 744 WP_000958858.1 glycerophosphoryl diester phosphodiesterase -
  OS078_RS03655 - 696887..697315 (+) 429 WP_000872606.1 MaoC family dehydratase -
  OS078_RS03660 mecA 697361..699370 (-) 2010 WP_267790023.1 PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA -
  OS078_RS03665 mecR1 699467..701224 (+) 1758 WP_000952923.1 beta-lactam sensor/signal transducer MecR1 -
  OS078_RS03670 mecI 701224..701595 (+) 372 Protein_692 mecA-type methicillin resistance repressor MecI -
  OS078_RS03675 psm-mec 701680..701748 (-) 69 WP_014532405.1 phenol-soluble modulin PSM-mec -
  OS078_RS03680 - 702068..703216 (+) 1149 WP_000427807.1 ROK family transcriptional regulator -
  OS078_RS03685 cstB 703330..704664 (-) 1335 Protein_695 persulfide dioxygenase-sulfurtransferase CstB -
  OS078_RS03690 - 704696..705760 (-) 1065 WP_000438836.1 DsrE/DsrF/DrsH-like family protein -
  OS078_RS03695 cstR 705896..706156 (+) 261 WP_000220507.1 persulfide-sensing transcriptional repressor CstR -
  OS078_RS03700 - 706156..706794 (+) 639 Protein_698 sulfite exporter TauE/SafE family protein -
  OS078_RS03705 - 707068..707685 (-) 618 WP_000562107.1 CadD family cadmium resistance transporter -
  OS078_RS03710 - 707766..710180 (-) 2415 WP_000378485.1 cadmium-translocating P-type ATPase CadA -
  OS078_RS03715 - 710173..710538 (-) 366 WP_000159127.1 ArsR/SmtB family transcription factor -
  OS078_RS03720 - 710724..711101 (-) 378 WP_001041908.1 DUF6262 family protein -
  OS078_RS03725 - 711108..713000 (-) 1893 WP_014532403.1 site-specific integrase -
  OS078_RS03730 - 713195..713518 (-) 324 WP_000088091.1 JAB domain-containing protein -
  OS078_RS03735 - 713511..713717 (-) 207 WP_001077283.1 hypothetical protein -
  OS078_RS03740 - 713719..714240 (-) 522 WP_000836008.1 DUF1643 domain-containing protein -
  OS078_RS03745 - 714259..714570 (-) 312 WP_000833212.1 DUF960 family protein -
  OS078_RS03750 - 714655..715005 (-) 351 WP_000171449.1 SAUGI family uracil-DNA glycosylase inhibitor -
  OS078_RS03755 ccrB 715476..717104 (-) 1629 WP_001186596.1 cassette chromosome recombinase CcrB Machinery gene
  OS078_RS03760 ccrA 717125..718471 (-) 1347 WP_000816499.1 cassette chromosome recombinase CcrA Machinery gene

Sequence


Protein


Download         Length: 541 a.a.        Molecular weight: 62401.31 Da        Isoelectric Point: 9.7182

>NTDB_id=759047 OS078_RS03390 WP_031926267.1 647431..649056(-) (ccrB) [Staphylococcus aureus strain Zed]
MDKMKKKLVGGYIRVSTERQVEGYSIEGQITQIEQYCQFNGYELVDIYADRGISGKSMNRPELQRMLNDAKNGKLDCVMV
YKTNRLARNTSDLLTIVEELHRQNVEFFSLSERMEVKNSTGKLMLQILASFSEFERNTILENIYTGQRQRALEGYYQGNL
PLGYNNIPDNKKELMINQHEANIVKYIFESYAKGHGYRKIANALNHKGYVTKKGNPFSISAVTYILSNPFYIGKIQFAKY
KDWNDKRRKGLNDKPVIAEGKHTPIISQSLWDKVQARKRQVSEKPQVHGKGTNILTGIISCPQCSAPMAASNTTNTLKDG
TKKRIRYYSCSNFRNKGSKVCSANSVRADVIEKYVMDQILEIVKSDKVLKQVVERVNQENQVDVAALNHDIAYKQQQFDE
ISTKLKNLIQTIEDNPDLTSALKPTIHQYETQLNDITNQINQLKHQQNQEKPFYDTKQIAALLQRIFQNIESMDKSQLKA
LYLTVIDRIDIRKDENHKKQFFVTLKLNNEIIKQLFNNNNLDEVLLSTSSLFLPQTLYFQI

Nucleotide


Download         Length: 1626 bp        

>NTDB_id=759047 OS078_RS03390 WP_031926267.1 647431..649056(-) (ccrB) [Staphylococcus aureus strain Zed]
ATGGATAAAATGAAGAAAAAGCTTGTAGGAGGCTACATTCGCGTATCCACAGAGAGACAAGTAGAAGGTTATAGCATCGA
GGGACAAATTACACAAATAGAGCAATATTGCCAATTTAATGGCTATGAACTCGTTGATATATATGCAGATCGGGGTATAT
CAGGAAAATCTATGAACCGTCCTGAATTACAGCGCATGTTAAATGATGCTAAAAATGGAAAATTAGACTGTGTTATGGTT
TATAAAACAAATCGTTTGGCACGTAATACTTCCGATTTACTTACAATCGTCGAAGAACTTCATCGCCAAAATGTTGAATT
TTTTAGCTTGTCTGAACGCATGGAAGTCAAAAATTCAACAGGCAAGTTAATGCTCCAGATACTTGCAAGTTTTTCCGAAT
TTGAAAGAAATACAATTTTAGAGAATATTTACACCGGACAACGTCAAAGAGCTTTAGAGGGCTATTATCAAGGCAATCTT
CCATTAGGATATAATAACATACCTGATAATAAAAAAGAATTAATGATTAATCAACATGAAGCTAACATCGTTAAATATAT
CTTTGAATCTTATGCCAAAGGTCATGGTTATCGTAAAATAGCCAATGCACTCAATCACAAAGGCTATGTGACTAAAAAAG
GCAATCCATTTAGTATTTCAGCTGTTACTTATATTCTCTCAAACCCATTCTATATTGGTAAAATTCAATTCGCGAAATAC
AAAGATTGGAATGATAAACGTCGTAAAGGCTTGAATGATAAGCCAGTAATCGCCGAGGGCAAACATACCCCTATTATTAG
TCAATCATTATGGGATAAAGTGCAAGCACGTAAGAGACAAGTAAGTGAAAAACCACAAGTCCATGGTAAAGGAACCAATA
TTTTAACTGGAATAATTTCGTGTCCCCAATGTTCTGCACCTATGGCTGCGAGTAACACCACAAACACACTTAAAGATGGC
ACTAAAAAACGTATTCGTTACTATTCGTGTAGTAATTTTCGAAATAAAGGCTCAAAGGTATGTTCTGCGAATAGTGTTAG
AGCCGATGTCATTGAAAAATATGTTATGGACCAAATACTTGAAATTGTCAAAAGTGATAAAGTTCTCAAACAAGTTGTCG
AACGTGTCAATCAAGAGAATCAAGTCGATGTAGCTGCACTTAACCATGATATTGCTTATAAACAACAACAATTTGATGAA
ATTAGCACTAAACTTAAAAATCTAATTCAAACCATCGAAGACAATCCAGACTTAACATCTGCACTCAAACCAACCATTCA
TCAATATGAAACACAACTGAATGATATCACAAACCAAATTAATCAACTCAAGCACCAACAAAATCAAGAGAAACCATTTT
ATGATACGAAACAAATCGCTGCTTTATTACAACGAATATTTCAAAATATAGAATCCATGGATAAATCACAGCTCAAAGCT
TTGTACCTAACGGTTATTGACCGTATTGACATCCGTAAAGATGAGAATCATAAAAAGCAATTCTTTGTTACACTAAAACT
TAATAATGAAATTATTAAACAACTTTTCAATAATAATAATCTAGACGAAGTGCTTCTCAGCACTTCGTCTTTGTTTTTGC
CTCAAACACTCTACTTTCAAATATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccrB Staphylococcus aureus N315

80.258

100

0.804