Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ORF34_RS17245 Genome accession   NZ_CP112873
Coordinates   3258898..3259038 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain O4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3253898..3264038
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORF34_RS17220 (ORF34_17220) yuxO 3254211..3254591 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ORF34_RS17225 (ORF34_17225) comA 3254610..3255254 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ORF34_RS17230 (ORF34_17230) comP 3255335..3257644 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  ORF34_RS17235 (ORF34_17235) comX 3257659..3257826 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ORF34_RS17240 (ORF34_17240) comQ 3257814..3258713 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ORF34_RS17245 (ORF34_17245) degQ 3258898..3259038 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ORF34_RS17250 (ORF34_17250) - 3259260..3259385 (+) 126 WP_003228793.1 hypothetical protein -
  ORF34_RS17255 (ORF34_17255) - 3259499..3259867 (+) 369 WP_003243784.1 hypothetical protein -
  ORF34_RS17260 (ORF34_17260) pdeH 3259843..3261072 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ORF34_RS17265 (ORF34_17265) pncB 3261209..3262681 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ORF34_RS17270 (ORF34_17270) pncA 3262697..3263248 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  ORF34_RS17275 (ORF34_17275) yueI 3263345..3263743 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=758608 ORF34_RS17245 WP_003220708.1 3258898..3259038(-) (degQ) [Bacillus subtilis strain O4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=758608 ORF34_RS17245 WP_003220708.1 3258898..3259038(-) (degQ) [Bacillus subtilis strain O4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1