Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU19_RS10910 | Genome accession | NZ_CP111144 |
| Coordinates | 2252565..2253017 (-) | Length | 150 a.a. |
| NCBI ID | WP_078801814.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2246548..2294708 | 2252565..2253017 | within | 0 |
Gene organization within MGE regions
Location: 2246548..2294708
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU19_RS10885 (ORU19_10885) | - | 2246557..2246931 (+) | 375 | WP_225529671.1 | LysR family transcriptional regulator | - |
| ORU19_RS10890 (ORU19_10890) | - | 2247177..2247587 (-) | 411 | WP_010907416.1 | hypothetical protein | - |
| ORU19_RS10895 (ORU19_10895) | - | 2247589..2249625 (-) | 2037 | WP_010907417.1 | integrase | - |
| ORU19_RS10900 (ORU19_10900) | - | 2249628..2251148 (-) | 1521 | WP_010907418.1 | site-specific integrase | - |
| ORU19_RS10905 (ORU19_10905) | - | 2251135..2252415 (-) | 1281 | WP_016533798.1 | site-specific integrase | - |
| ORU19_RS10910 (ORU19_10910) | ssb | 2252565..2253017 (-) | 453 | WP_078801814.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU19_RS10915 (ORU19_10915) | - | 2253017..2253676 (-) | 660 | WP_266212962.1 | translocation protein TolB precursor | - |
| ORU19_RS10920 (ORU19_10920) | - | 2253663..2254616 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU19_RS10925 (ORU19_10925) | - | 2254618..2254905 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU19_RS10930 (ORU19_10930) | - | 2254918..2255154 (-) | 237 | WP_075271355.1 | hypothetical protein | - |
| ORU19_RS10935 (ORU19_10935) | - | 2255126..2255425 (-) | 300 | WP_078802174.1 | hypothetical protein | - |
| ORU19_RS10940 (ORU19_10940) | - | 2255573..2255803 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU19_RS10945 (ORU19_10945) | - | 2255865..2256623 (-) | 759 | WP_323135003.1 | KilA-N domain-containing protein | - |
| ORU19_RS10950 (ORU19_10950) | - | 2256762..2257139 (-) | 378 | Protein_2112 | Bro-N domain-containing protein | - |
| ORU19_RS10955 (ORU19_10955) | - | 2257503..2257697 (+) | 195 | WP_014391459.1 | hypothetical protein | - |
| ORU19_RS10960 (ORU19_10960) | - | 2257678..2257848 (-) | 171 | WP_225529669.1 | hypothetical protein | - |
| ORU19_RS10965 (ORU19_10965) | - | 2257861..2258091 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU19_RS10970 (ORU19_10970) | - | 2258333..2258542 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU19_RS10975 (ORU19_10975) | - | 2258555..2258722 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU19_RS10980 (ORU19_10980) | - | 2259028..2259342 (+) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ORU19_RS10985 (ORU19_10985) | - | 2259339..2259629 (+) | 291 | WP_078819686.1 | addiction module antidote protein | - |
| ORU19_RS10990 (ORU19_10990) | - | 2259655..2260059 (-) | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU19_RS10995 (ORU19_10995) | - | 2260089..2261933 (-) | 1845 | WP_071523830.1 | DEAD/DEAH box helicase | - |
| ORU19_RS11000 (ORU19_11000) | - | 2262144..2262827 (-) | 684 | WP_099821842.1 | helix-turn-helix transcriptional regulator | - |
| ORU19_RS11005 (ORU19_11005) | - | 2262952..2263152 (+) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| ORU19_RS11010 (ORU19_11010) | - | 2263201..2263650 (+) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| ORU19_RS11015 (ORU19_11015) | - | 2263708..2264391 (+) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU19_RS11020 (ORU19_11020) | - | 2264388..2264603 (+) | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU19_RS11025 (ORU19_11025) | - | 2264600..2265436 (+) | 837 | WP_225529668.1 | helix-turn-helix domain-containing protein | - |
| ORU19_RS11030 (ORU19_11030) | - | 2265436..2266125 (+) | 690 | WP_225529667.1 | replication protein P | - |
| ORU19_RS11035 (ORU19_11035) | - | 2266129..2266665 (+) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| ORU19_RS11040 (ORU19_11040) | - | 2266655..2267113 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| ORU19_RS11045 (ORU19_11045) | - | 2267187..2267402 (+) | 216 | WP_225529666.1 | hypothetical protein | - |
| ORU19_RS11050 (ORU19_11050) | - | 2267395..2267997 (+) | 603 | WP_170376544.1 | recombination protein NinG | - |
| ORU19_RS11055 (ORU19_11055) | - | 2267998..2268459 (+) | 462 | WP_225529665.1 | antiterminator Q family protein | - |
| ORU19_RS11060 (ORU19_11060) | - | 2268585..2269148 (-) | 564 | WP_014667793.1 | hypothetical protein | - |
| ORU19_RS11065 (ORU19_11065) | - | 2269266..2269523 (+) | 258 | WP_081376958.1 | HP1 family phage holin | - |
| ORU19_RS11070 (ORU19_11070) | - | 2269520..2270050 (+) | 531 | WP_069915984.1 | lysozyme | - |
| ORU19_RS11075 (ORU19_11075) | - | 2270023..2270346 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU19_RS11080 (ORU19_11080) | - | 2270556..2270924 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| ORU19_RS11085 (ORU19_11085) | - | 2270960..2271220 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| ORU19_RS11090 (ORU19_11090) | - | 2271510..2271983 (+) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| ORU19_RS11095 (ORU19_11095) | - | 2271987..2274095 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| ORU19_RS11100 (ORU19_11100) | - | 2274092..2274313 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| ORU19_RS11105 (ORU19_11105) | - | 2274310..2275848 (+) | 1539 | WP_016533224.1 | phage portal protein | - |
| ORU19_RS11110 (ORU19_11110) | - | 2275784..2277793 (+) | 2010 | WP_078819665.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| ORU19_RS11115 (ORU19_11115) | - | 2277866..2278192 (+) | 327 | WP_016570083.1 | DUF2190 family protein | - |
| ORU19_RS11120 (ORU19_11120) | - | 2278185..2278478 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| ORU19_RS11125 (ORU19_11125) | - | 2278478..2279029 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| ORU19_RS11130 (ORU19_11130) | gpU | 2279026..2279433 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| ORU19_RS11135 (ORU19_11135) | - | 2279430..2279936 (+) | 507 | WP_078819785.1 | phage tail tube protein | - |
| ORU19_RS11140 (ORU19_11140) | - | 2279942..2280331 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| ORU19_RS11145 (ORU19_11145) | - | 2280352..2280654 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| ORU19_RS11150 (ORU19_11150) | - | 2280641..2283034 (+) | 2394 | WP_225529664.1 | phage tail length tape measure family protein | - |
| ORU19_RS11155 (ORU19_11155) | - | 2283031..2283381 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| ORU19_RS11160 (ORU19_11160) | - | 2283453..2284019 (+) | 567 | WP_078819667.1 | hypothetical protein | - |
| ORU19_RS11165 (ORU19_11165) | - | 2284173..2284877 (+) | 705 | WP_080166595.1 | phage minor tail protein L | - |
| ORU19_RS11170 (ORU19_11170) | - | 2284882..2285625 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU19_RS11175 (ORU19_11175) | - | 2285568..2286188 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU19_RS11180 (ORU19_11180) | - | 2286192..2292086 (+) | 5895 | WP_266212963.1 | phage tail protein | - |
| ORU19_RS11185 (ORU19_11185) | - | 2292134..2292457 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU19_RS11190 (ORU19_11190) | - | 2292883..2293719 (+) | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| ORU19_RS11195 (ORU19_11195) | - | 2294022..2294708 (+) | 687 | WP_225529662.1 | KilA-N domain-containing protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17107.99 Da Isoelectric Point: 7.9707
>NTDB_id=758142 ORU19_RS10910 WP_078801814.1 2252565..2253017(-) (ssb) [Pasteurella multocida strain PF7]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=758142 ORU19_RS10910 WP_078801814.1 2252565..2253017(-) (ssb) [Pasteurella multocida strain PF7]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
60.556 |
100 |
0.727 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
92.667 |
0.487 |
| ssb | Neisseria gonorrhoeae MS11 |
44.526 |
91.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
44.526 |
91.333 |
0.407 |