Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   OQE53_RS11575 Genome accession   NZ_CP111072
Coordinates   2409416..2409853 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain YFI-E109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2404416..2414853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OQE53_RS11525 sinI 2404799..2404972 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  OQE53_RS11530 sinR 2405006..2405341 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OQE53_RS11535 tasA 2405389..2406174 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  OQE53_RS11540 sipW 2406239..2406823 (-) 585 WP_032874025.1 signal peptidase I SipW -
  OQE53_RS11545 tapA 2406795..2407466 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OQE53_RS11550 - 2407725..2408054 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OQE53_RS11555 - 2408095..2408274 (-) 180 WP_022552966.1 YqzE family protein -
  OQE53_RS11560 comGG 2408331..2408708 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OQE53_RS11565 comGF 2408709..2409173 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  OQE53_RS11570 comGE 2409118..2409432 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OQE53_RS11575 comGD 2409416..2409853 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OQE53_RS11580 comGC 2409843..2410151 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  OQE53_RS11585 comGB 2410156..2411193 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  OQE53_RS11590 comGA 2411180..2412250 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  OQE53_RS11595 - 2412447..2413397 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  OQE53_RS11600 - 2413543..2414844 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=757589 OQE53_RS11575 WP_007612572.1 2409416..2409853(-) (comGD) [Bacillus velezensis strain YFI-E109]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=757589 OQE53_RS11575 WP_007612572.1 2409416..2409853(-) (comGD) [Bacillus velezensis strain YFI-E109]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559