Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OQE53_RS11525 Genome accession   NZ_CP111072
Coordinates   2404799..2404972 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain YFI-E109     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2399799..2409972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OQE53_RS11510 gcvT 2400613..2401713 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  OQE53_RS11515 - 2402136..2403806 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  OQE53_RS11520 - 2403828..2404622 (+) 795 WP_007612541.1 YqhG family protein -
  OQE53_RS11525 sinI 2404799..2404972 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  OQE53_RS11530 sinR 2405006..2405341 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OQE53_RS11535 tasA 2405389..2406174 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  OQE53_RS11540 sipW 2406239..2406823 (-) 585 WP_032874025.1 signal peptidase I SipW -
  OQE53_RS11545 tapA 2406795..2407466 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OQE53_RS11550 - 2407725..2408054 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OQE53_RS11555 - 2408095..2408274 (-) 180 WP_022552966.1 YqzE family protein -
  OQE53_RS11560 comGG 2408331..2408708 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OQE53_RS11565 comGF 2408709..2409173 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  OQE53_RS11570 comGE 2409118..2409432 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OQE53_RS11575 comGD 2409416..2409853 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=757585 OQE53_RS11525 WP_032874029.1 2404799..2404972(+) (sinI) [Bacillus velezensis strain YFI-E109]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=757585 OQE53_RS11525 WP_032874029.1 2404799..2404972(+) (sinI) [Bacillus velezensis strain YFI-E109]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719