Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   OQ358_RS00630 Genome accession   NZ_CP110922
Coordinates   106353..106835 (+) Length   160 a.a.
NCBI ID   WP_058085720.1    Uniprot ID   -
Organism   Listeria monocytogenes strain 11-04869     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 91839..133764 106353..106835 within 0


Gene organization within MGE regions


Location: 91839..133764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OQ358_RS00480 (OQ358_00480) - 91839..93041 (-) 1203 WP_003734959.1 site-specific integrase -
  OQ358_RS00485 (OQ358_00485) - 93107..93847 (-) 741 WP_003734960.1 hypothetical protein -
  OQ358_RS00490 (OQ358_00490) - 93869..94591 (-) 723 WP_003727738.1 hypothetical protein -
  OQ358_RS00495 (OQ358_00495) - 94607..94825 (-) 219 WP_003727739.1 zinc-ribbon domain-containing protein -
  OQ358_RS00500 (OQ358_00500) - 94848..95339 (-) 492 WP_003727740.1 ImmA/IrrE family metallo-endopeptidase -
  OQ358_RS00505 (OQ358_00505) - 95372..95677 (-) 306 WP_003727741.1 helix-turn-helix transcriptional regulator -
  OQ358_RS00510 (OQ358_00510) - 95803..96045 (+) 243 WP_003727742.1 helix-turn-helix transcriptional regulator -
  OQ358_RS00515 (OQ358_00515) - 96049..96333 (+) 285 WP_003735006.1 hypothetical protein -
  OQ358_RS00520 (OQ358_00520) - 96359..96640 (+) 282 WP_003727747.1 hypothetical protein -
  OQ358_RS00525 (OQ358_00525) - 96672..96833 (+) 162 WP_003735005.1 hypothetical protein -
  OQ358_RS00530 (OQ358_00530) - 96826..97068 (-) 243 WP_003727749.1 hypothetical protein -
  OQ358_RS00535 (OQ358_00535) - 97076..97150 (+) 75 Protein_105 hypothetical protein -
  OQ358_RS00540 (OQ358_00540) - 97132..97911 (+) 780 WP_061671714.1 phage antirepressor KilAC domain-containing protein -
  OQ358_RS00545 (OQ358_00545) - 98033..98557 (+) 525 WP_061092555.1 hypothetical protein -
  OQ358_RS00550 (OQ358_00550) - 98564..98749 (+) 186 WP_003731816.1 helix-turn-helix domain-containing protein -
  OQ358_RS00555 (OQ358_00555) - 98765..98953 (+) 189 WP_003734954.1 gp45 family putative tail fiber system protein -
  OQ358_RS00560 (OQ358_00560) - 99186..100145 (+) 960 WP_077947796.1 YqaJ viral recombinase family protein -
  OQ358_RS00565 (OQ358_00565) - 100145..100960 (+) 816 WP_003740960.1 recombinase RecT -
  OQ358_RS00570 (OQ358_00570) - 100990..101916 (+) 927 WP_061092554.1 hypothetical protein -
  OQ358_RS00575 (OQ358_00575) - 101913..102080 (+) 168 WP_010990198.1 hypothetical protein -
  OQ358_RS00580 (OQ358_00580) - 102096..102377 (+) 282 WP_041918346.1 hypothetical protein -
  OQ358_RS00585 (OQ358_00585) - 102374..103186 (+) 813 WP_003734949.1 DNA adenine methylase -
  OQ358_RS00590 (OQ358_00590) - 103183..103815 (+) 633 WP_003734948.1 DUF1642 domain-containing protein -
  OQ358_RS00595 (OQ358_00595) - 103812..104333 (+) 522 WP_031644380.1 YopX family protein -
  OQ358_RS00600 (OQ358_00600) - 104460..104852 (+) 393 WP_061092564.1 YopX family protein -
  OQ358_RS00605 (OQ358_00605) - 104849..105034 (+) 186 WP_003727764.1 hypothetical protein -
  OQ358_RS00610 (OQ358_00610) - 105031..105321 (+) 291 WP_020830811.1 hypothetical protein -
  OQ358_RS00615 (OQ358_00615) - 105507..105701 (+) 195 WP_020830812.1 hypothetical protein -
  OQ358_RS00620 (OQ358_00620) - 105716..105943 (+) 228 WP_058085718.1 ASCH/PUA domain-containing protein -
  OQ358_RS00625 (OQ358_00625) - 105955..106356 (+) 402 WP_058085719.1 hypothetical protein -
  OQ358_RS00630 (OQ358_00630) ssbA 106353..106835 (+) 483 WP_058085720.1 single-stranded DNA-binding protein Machinery gene
  OQ358_RS00635 (OQ358_00635) - 106856..107047 (+) 192 WP_003734994.1 hypothetical protein -
  OQ358_RS00640 (OQ358_00640) - 106992..107396 (+) 405 WP_015987089.1 DUF1064 domain-containing protein -
  OQ358_RS00645 (OQ358_00645) - 107400..107783 (+) 384 WP_015987090.1 DUF2481 family protein -
  OQ358_RS00650 (OQ358_00650) - 107913..108077 (+) 165 WP_015987092.1 hypothetical protein -
  OQ358_RS00655 (OQ358_00655) - 108096..108530 (+) 435 WP_015987093.1 ArpU family phage packaging/lysis transcriptional regulator -
  OQ358_RS00660 (OQ358_00660) - 108891..109454 (+) 564 WP_134056131.1 hypothetical protein -
  OQ358_RS00665 (OQ358_00665) - 109551..109736 (+) 186 WP_015987095.1 hypothetical protein -
  OQ358_RS00670 (OQ358_00670) - 109778..110320 (+) 543 WP_015987044.1 terminase small subunit -
  OQ358_RS00675 (OQ358_00675) - 110289..111620 (+) 1332 WP_061092535.1 PBSX family phage terminase large subunit -
  OQ358_RS00680 (OQ358_00680) - 111633..113132 (+) 1500 WP_003743397.1 phage portal protein -
  OQ358_RS00685 (OQ358_00685) - 113138..114277 (+) 1140 WP_003734943.1 phage minor capsid protein -
  OQ358_RS00690 (OQ358_00690) - 114356..114946 (+) 591 WP_003734944.1 phage scaffolding protein -
  OQ358_RS00695 (OQ358_00695) - 114946..115947 (+) 1002 WP_003734945.1 major capsid protein -
  OQ358_RS00700 (OQ358_00700) - 115966..116361 (+) 396 WP_003734946.1 hypothetical protein -
  OQ358_RS00705 (OQ358_00705) - 116361..116723 (+) 363 WP_003743399.1 putative minor capsid protein -
  OQ358_RS00710 (OQ358_00710) - 116723..117061 (+) 339 WP_003743401.1 minor capsid protein -
  OQ358_RS00715 (OQ358_00715) - 117061..117468 (+) 408 WP_003743402.1 minor capsid protein -
  OQ358_RS00720 (OQ358_00720) - 117471..117908 (+) 438 WP_003735047.1 hypothetical protein -
  OQ358_RS00725 (OQ358_00725) - 117838..118170 (+) 333 WP_074384949.1 Ig-like domain-containing protein -
  OQ358_RS00730 (OQ358_00730) - 118223..118645 (+) 423 WP_003743404.1 phage tail assembly chaperone -
  OQ358_RS00735 (OQ358_00735) - 118651..119256 (+) 606 WP_021496958.1 bacteriophage Gp15 family protein -
  OQ358_RS00740 (OQ358_00740) - 119267..124633 (+) 5367 WP_061092536.1 tape measure protein -
  OQ358_RS00745 (OQ358_00745) - 124630..125457 (+) 828 WP_003743410.1 phage tail family protein -
  OQ358_RS00750 (OQ358_00750) - 125472..126494 (+) 1023 WP_015987056.1 phage tail protein -
  OQ358_RS00755 (OQ358_00755) - 126495..127520 (+) 1026 WP_010990226.1 hypothetical protein -
  OQ358_RS00760 (OQ358_00760) - 127517..128584 (+) 1068 WP_010990227.1 BppU family phage baseplate upper protein -
  OQ358_RS00765 (OQ358_00765) - 128581..128922 (+) 342 WP_003759716.1 hypothetical protein -
  OQ358_RS00770 (OQ358_00770) - 128923..129069 (+) 147 WP_012581446.1 XkdX family protein -
  OQ358_RS00775 (OQ358_00775) - 129110..129415 (+) 306 WP_003733957.1 hypothetical protein -
  OQ358_RS00780 (OQ358_00780) - 129412..129696 (+) 285 WP_223196393.1 phage holin -
  OQ358_RS00785 (OQ358_00785) - 129696..130646 (+) 951 WP_058085736.1 N-acetylmuramoyl-L-alanine amidase family protein -
  OQ358_RS00790 (OQ358_00790) - 130791..131492 (+) 702 WP_003743979.1 DUF3800 domain-containing protein -
  OQ358_RS00795 (OQ358_00795) - 132252..132881 (+) 630 WP_058085743.1 hypothetical protein -
  OQ358_RS00800 (OQ358_00800) - 133328..133561 (+) 234 WP_058085737.1 hypothetical protein -
  OQ358_RS00805 (OQ358_00805) - 133558..133764 (+) 207 WP_058085738.1 hypothetical protein -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 17735.60 Da        Isoelectric Point: 4.8192

>NTDB_id=756954 OQ358_RS00630 WP_058085720.1 106353..106835(+) (ssbA) [Listeria monocytogenes strain 11-04869]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENAANFLKKGSMAGVDGRVQTR
NYEDSDGKRVFVTEVVAETVQFLEPKNINAEGATSNNYQNQANYSNNNKTSSYRADTSQKSDSFADEGKAIDINEDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=756954 OQ358_RS00630 WP_058085720.1 106353..106835(+) (ssbA) [Listeria monocytogenes strain 11-04869]
ATGATGAACCGTGTAGTGCTTGTAGGACGATTAACGAAAGACCCTGAATTACGTTACACTCCAGCTGGAGTAGCTGTTGC
GACTTTTACGCTAGCAGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGTAAACCAGCGGAAAACGCAGCTAATTTCTTGAAAAAAGGAAGCATGGCAGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGACAGCGACGGTAAACGCGTTTTCGTTACTGAGGTAGTTGCTGAAACAGTTCAATTCTTAGAGCCTAAAAA
TATCAACGCAGAAGGCGCTACATCGAATAATTATCAAAACCAAGCTAATTATTCAAATAACAATAAAACAAGCTCATATC
GAGCAGATACGAGTCAGAAGAGTGATTCATTTGCAGACGAAGGCAAGGCGATTGATATTAATGAAGATGATTTGCCATTT
TGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.047

100

0.656

  ssb Latilactobacillus sakei subsp. sakei 23K

54.118

100

0.575

  ssbB Bacillus subtilis subsp. subtilis str. 168

65.094

66.25

0.431