Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   OP858_RS07625 Genome accession   NZ_CP110784
Coordinates   1555260..1556132 (-) Length   290 a.a.
NCBI ID   WP_002453082.1    Uniprot ID   -
Organism   Staphylococcus capitis strain CCSM0123     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1509935..1584108 1555260..1556132 within 0


Gene organization within MGE regions


Location: 1509935..1584108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OP858_RS07445 (OP858_07445) recA 1511498..1512550 (-) 1053 WP_002437037.1 recombinase RecA Machinery gene
  OP858_RS07450 (OP858_07450) - 1512719..1513867 (-) 1149 WP_267263380.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  OP858_RS07455 (OP858_07455) pgsA 1514009..1514590 (-) 582 WP_002453113.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  OP858_RS07460 (OP858_07460) - 1514618..1515010 (-) 393 WP_016898116.1 helix-turn-helix domain-containing protein -
  OP858_RS07465 (OP858_07465) - 1515029..1515856 (-) 828 WP_016898115.1 YmfK family protein -
  OP858_RS07470 (OP858_07470) ymfI 1516038..1516745 (-) 708 WP_002453110.1 elongation factor P 5-aminopentanone reductase -
  OP858_RS07475 (OP858_07475) yfmH 1516745..1518031 (-) 1287 WP_002453109.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  OP858_RS07480 (OP858_07480) yfmF 1518031..1519305 (-) 1275 WP_267263381.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  OP858_RS07485 (OP858_07485) - 1519346..1520056 (-) 711 WP_267263382.1 GntR family transcriptional regulator -
  OP858_RS07490 (OP858_07490) - 1520059..1522479 (-) 2421 WP_002453106.1 DNA translocase FtsK -
  OP858_RS07495 (OP858_07495) rnjB 1522728..1524401 (-) 1674 WP_002453105.1 ribonuclease J2 -
  OP858_RS07500 (OP858_07500) pnp 1524633..1526732 (-) 2100 WP_016898112.1 polyribonucleotide nucleotidyltransferase -
  OP858_RS07505 (OP858_07505) rpsO 1526888..1527157 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  OP858_RS07510 (OP858_07510) ribF 1527279..1528250 (-) 972 WP_002453103.1 riboflavin biosynthesis protein RibF -
  OP858_RS07515 (OP858_07515) truB 1528266..1529183 (-) 918 WP_002453102.1 tRNA pseudouridine(55) synthase TruB -
  OP858_RS07520 (OP858_07520) rbfA 1529326..1529676 (-) 351 WP_002453101.1 30S ribosome-binding factor RbfA -
  OP858_RS07525 (OP858_07525) infB 1529834..1532008 (-) 2175 WP_016898111.1 translation initiation factor IF-2 -
  OP858_RS07530 (OP858_07530) - 1532013..1532330 (-) 318 WP_002453099.1 L7Ae/L30e/S12e/Gadd45 family ribosomal protein -
  OP858_RS07535 (OP858_07535) rnpM 1532327..1532611 (-) 285 WP_002453098.1 RNase P modulator RnpM -
  OP858_RS07540 (OP858_07540) nusA 1532628..1533851 (-) 1224 WP_016898110.1 transcription termination factor NusA -
  OP858_RS07545 (OP858_07545) rimP 1533872..1534339 (-) 468 WP_002453096.1 ribosome maturation factor RimP -
  OP858_RS07550 (OP858_07550) - 1534566..1538876 (-) 4311 WP_267263597.1 PolC-type DNA polymerase III -
  OP858_RS07555 (OP858_07555) - 1539133..1540836 (-) 1704 WP_002453094.1 proline--tRNA ligase -
  OP858_RS07560 (OP858_07560) rseP 1540856..1542142 (-) 1287 WP_002453093.1 RIP metalloprotease RseP -
  OP858_RS07565 (OP858_07565) - 1542382..1543164 (-) 783 WP_002453092.1 phosphatidate cytidylyltransferase -
  OP858_RS07570 (OP858_07570) - 1543168..1543938 (-) 771 WP_002453091.1 isoprenyl transferase -
  OP858_RS07575 (OP858_07575) frr 1544214..1544768 (-) 555 WP_002453090.1 ribosome recycling factor -
  OP858_RS07580 (OP858_07580) pyrH 1544785..1545507 (-) 723 WP_002436299.1 UMP kinase -
  OP858_RS07585 (OP858_07585) tsf 1545644..1546522 (-) 879 WP_002453089.1 translation elongation factor Ts -
  OP858_RS07590 (OP858_07590) rpsB 1546673..1547461 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  OP858_RS07595 (OP858_07595) codY 1547717..1548490 (-) 774 WP_002436324.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  OP858_RS07600 (OP858_07600) hslU 1548513..1549916 (-) 1404 WP_002453087.1 ATP-dependent protease ATPase subunit HslU -
  OP858_RS07605 (OP858_07605) hslV 1550001..1550543 (-) 543 WP_002453086.1 ATP-dependent protease subunit HslV -
  OP858_RS07610 (OP858_07610) xerC 1550547..1551437 (-) 891 WP_002453085.1 tyrosine recombinase XerC -
  OP858_RS07615 (OP858_07615) trmFO 1551674..1552981 (-) 1308 WP_002453084.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  OP858_RS07620 (OP858_07620) topA 1553007..1555082 (-) 2076 WP_029625697.1 type I DNA topoisomerase -
  OP858_RS07625 (OP858_07625) dprA 1555260..1556132 (-) 873 WP_002453082.1 DNA-processing protein DprA Machinery gene
  OP858_RS07630 (OP858_07630) sucD 1556620..1557528 (-) 909 WP_002453081.1 succinate--CoA ligase subunit alpha -
  OP858_RS07635 (OP858_07635) sucC 1557550..1558716 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  OP858_RS07640 (OP858_07640) - 1558824..1559594 (-) 771 WP_002453080.1 ribonuclease HII -
  OP858_RS07645 (OP858_07645) ylqF 1559596..1560462 (-) 867 WP_267263383.1 ribosome biogenesis GTPase YlqF -
  OP858_RS07650 (OP858_07650) - 1560742..1563342 (+) 2601 WP_064262579.1 YfhO family protein -
  OP858_RS07655 (OP858_07655) - 1563335..1565956 (+) 2622 WP_002453077.1 YfhO family protein -
  OP858_RS07660 (OP858_07660) - 1566052..1566192 (-) 141 Protein_1463 IS3 family transposase -
  OP858_RS07665 (OP858_07665) - 1566404..1566562 (+) 159 WP_002453076.1 hypothetical protein -
  OP858_RS07670 (OP858_07670) - 1566883..1567050 (+) 168 WP_229716903.1 hypothetical protein -
  OP858_RS07675 (OP858_07675) rplS 1567627..1567977 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  OP858_RS07680 (OP858_07680) trmD 1568083..1568820 (-) 738 WP_267263384.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  OP858_RS07685 (OP858_07685) rimM 1568820..1569323 (-) 504 WP_002453072.1 ribosome maturation factor RimM -
  OP858_RS07690 (OP858_07690) rpsP 1569610..1569885 (-) 276 WP_002453071.1 30S ribosomal protein S16 -
  OP858_RS07695 (OP858_07695) ffh 1570311..1571678 (-) 1368 WP_002453070.1 signal recognition particle protein -
  OP858_RS07700 (OP858_07700) - 1571709..1572041 (-) 333 WP_002453069.1 putative DNA-binding protein -
  OP858_RS07705 (OP858_07705) ftsY 1572028..1573287 (-) 1260 WP_002453068.1 signal recognition particle-docking protein FtsY -
  OP858_RS07710 (OP858_07710) smc 1573284..1576853 (-) 3570 WP_267263385.1 chromosome segregation protein SMC -
  OP858_RS07715 (OP858_07715) rnc 1576977..1577690 (-) 714 WP_222127027.1 ribonuclease III -
  OP858_RS07720 (OP858_07720) - 1577831..1578064 (-) 234 WP_267263386.1 acyl carrier protein -
  OP858_RS07725 (OP858_07725) fabG 1578663..1579397 (-) 735 WP_002435264.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  OP858_RS07730 (OP858_07730) fabD 1579390..1580316 (-) 927 WP_049390984.1 ACP S-malonyltransferase -
  OP858_RS07735 (OP858_07735) plsX 1580309..1581295 (-) 987 WP_267263387.1 phosphate acyltransferase PlsX -
  OP858_RS07740 (OP858_07740) fapR 1581288..1581857 (-) 570 WP_002453061.1 transcription factor FapR -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33453.46 Da        Isoelectric Point: 9.1538

>NTDB_id=756104 OP858_RS07625 WP_002453082.1 1555260..1556132(-) (dprA) [Staphylococcus capitis strain CCSM0123]
MIQHILLKLYWANFTTTQIHQFIKDYPEVISESPPTQKEMIEDWTIRQTTSTLKKKFNLFKSLDTEVLLQEMSKKNLKFL
TYFDKNYPQLLKEIYDFPYIIFYKGNKQLFNYPHTLAVIGSRKSTSYTTQALEYLFPSFKQLKMTIISGLAYGADSVAHQ
VALKNQLPTIGVLGFGHSYHYPKSTFKTRESVEREGLVISEYPPHSPISRYKFPERNRLISGLARGLLITEAEEISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDESSILSDYNF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=756104 OP858_RS07625 WP_002453082.1 1555260..1556132(-) (dprA) [Staphylococcus capitis strain CCSM0123]
GTGATCCAACATATTTTATTGAAGCTCTATTGGGCTAATTTCACCACCACTCAAATTCATCAATTCATTAAAGATTACCC
TGAAGTTATATCAGAAAGCCCTCCAACTCAAAAAGAAATGATTGAAGATTGGACTATAAGACAAACCACCTCCACATTGA
AGAAAAAATTCAACTTATTTAAATCACTTGATACAGAAGTTCTACTTCAAGAAATGTCAAAAAAGAACCTCAAATTTTTA
ACTTACTTTGATAAAAATTATCCTCAATTACTTAAAGAAATTTATGATTTTCCATATATAATATTTTACAAAGGAAATAA
ACAACTATTTAACTATCCGCATACTTTAGCTGTTATAGGATCAAGAAAGTCCACTTCATATACCACACAAGCATTAGAAT
ATCTATTTCCCTCATTTAAACAACTAAAAATGACGATTATATCAGGATTAGCATACGGTGCAGATAGTGTAGCTCATCAA
GTTGCACTAAAAAATCAACTGCCAACAATAGGAGTTCTTGGTTTTGGACATTCATATCATTATCCTAAATCAACTTTTAA
AACAAGAGAGAGTGTCGAACGAGAAGGGCTCGTTATAAGTGAGTATCCGCCGCATTCTCCTATATCCAGATATAAATTTC
CAGAAAGAAATAGATTGATTAGTGGTCTCGCTCGAGGTTTATTAATTACAGAAGCAGAGGAAATAAGTGGTAGTCAAATA
ACAGTAGATTGCGCTTTAGAACAAAATCGAAATGTATATGTTTTACCAGGATCAATGTTCAATCCTATGACCAAAAGTAA
TTTACTTAGGCTTCAAGAGGGTGCACAAGTAGTTTTAGATGAAAGTAGTATCCTTTCGGACTACAATTTCTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

58.681

99.31

0.583
  dprA Staphylococcus aureus MW2

58.681

99.31

0.583