Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OOZ27_RS18055 Genome accession   NZ_CP110634
Coordinates   3368104..3368244 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MG-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3363104..3373244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OOZ27_RS18030 (OOZ27_18030) yuxO 3363380..3363760 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  OOZ27_RS18035 (OOZ27_18035) comA 3363779..3364423 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  OOZ27_RS18040 (OOZ27_18040) comP 3364504..3366816 (-) 2313 WP_144460405.1 histidine kinase Regulator
  OOZ27_RS18045 (OOZ27_18045) comX 3366832..3367053 (-) 222 WP_014114983.1 competence pheromone ComX -
  OOZ27_RS18050 (OOZ27_18050) - 3367050..3367919 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  OOZ27_RS18055 (OOZ27_18055) degQ 3368104..3368244 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  OOZ27_RS18060 (OOZ27_18060) - 3368466..3368591 (+) 126 WP_141770195.1 hypothetical protein -
  OOZ27_RS18065 (OOZ27_18065) - 3368706..3369074 (+) 369 WP_014477834.1 hypothetical protein -
  OOZ27_RS18070 (OOZ27_18070) pdeH 3369050..3370279 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  OOZ27_RS18075 (OOZ27_18075) pncB 3370416..3371888 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  OOZ27_RS18080 (OOZ27_18080) pncA 3371904..3372455 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  OOZ27_RS18085 (OOZ27_18085) yueI 3372552..3372950 (-) 399 WP_015714628.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=755526 OOZ27_RS18055 WP_003220708.1 3368104..3368244(-) (degQ) [Bacillus subtilis strain MG-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=755526 OOZ27_RS18055 WP_003220708.1 3368104..3368244(-) (degQ) [Bacillus subtilis strain MG-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1