Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   OM992_RS01985 Genome accession   NZ_CP110268
Coordinates   412498..412617 (+) Length   39 a.a.
NCBI ID   WP_016937261.1    Uniprot ID   -
Organism   Bacillus siamensis strain YB-1631     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 407498..417617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OM992_RS01970 (OM992_01970) - 409109..409792 (+) 684 WP_264819626.1 response regulator transcription factor -
  OM992_RS01975 (OM992_01975) - 409779..411212 (+) 1434 WP_264819627.1 HAMP domain-containing sensor histidine kinase -
  OM992_RS01980 (OM992_01980) rapC 411366..412514 (+) 1149 WP_049627885.1 tetratricopeptide repeat protein Regulator
  OM992_RS01985 (OM992_01985) phrC 412498..412617 (+) 120 WP_016937261.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  OM992_RS01990 (OM992_01990) - 412759..412857 (-) 99 WP_016937260.1 YjcZ family sporulation protein -
  OM992_RS01995 (OM992_01995) - 412954..414318 (-) 1365 WP_016937259.1 aspartate kinase -
  OM992_RS02000 (OM992_02000) ceuB 414733..415686 (+) 954 WP_045926248.1 ABC transporter permease Machinery gene
  OM992_RS02005 (OM992_02005) - 415676..416623 (+) 948 WP_264819630.1 iron chelate uptake ABC transporter family permease subunit -
  OM992_RS02010 (OM992_02010) - 416617..417375 (+) 759 WP_016937256.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=753637 OM992_RS01985 WP_016937261.1 412498..412617(+) (phrC) [Bacillus siamensis strain YB-1631]
MKLKSKWFVICLAAAAIFTVAGAGQTDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=753637 OM992_RS01985 WP_016937261.1 412498..412617(+) (phrC) [Bacillus siamensis strain YB-1631]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTTGCAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

77.5

100

0.795