Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OMK57_RS16070 Genome accession   NZ_CP110264
Coordinates   3191404..3191544 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain HMB20199     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3186404..3196544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OMK57_RS16045 (OMK57_16045) - 3186728..3187108 (-) 381 WP_069486982.1 hotdog fold thioesterase -
  OMK57_RS16050 (OMK57_16050) comA 3187126..3187770 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  OMK57_RS16055 (OMK57_16055) comP 3187851..3190169 (-) 2319 WP_069486981.1 sensor histidine kinase Regulator
  OMK57_RS16060 (OMK57_16060) comX 3190189..3190365 (-) 177 WP_041906074.1 competence pheromone ComX -
  OMK57_RS16065 (OMK57_16065) - 3190380..3191273 (-) 894 WP_306481639.1 polyprenyl synthetase family protein -
  OMK57_RS16070 (OMK57_16070) degQ 3191404..3191544 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  OMK57_RS16075 (OMK57_16075) - 3192005..3192373 (+) 369 WP_044158947.1 hypothetical protein -
  OMK57_RS16080 (OMK57_16080) - 3192349..3193578 (-) 1230 WP_059334756.1 EAL and HDOD domain-containing protein -
  OMK57_RS16085 (OMK57_16085) - 3193714..3195183 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  OMK57_RS16090 (OMK57_16090) - 3195199..3195750 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  OMK57_RS16095 (OMK57_16095) - 3195846..3196244 (-) 399 WP_059334761.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=753590 OMK57_RS16070 WP_024122683.1 3191404..3191544(-) (degQ) [Bacillus halotolerans strain HMB20199]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=753590 OMK57_RS16070 WP_024122683.1 3191404..3191544(-) (degQ) [Bacillus halotolerans strain HMB20199]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978