Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   OKW88_RS06030 Genome accession   NZ_CP110105
Coordinates   1216553..1216936 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain CF03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1211553..1221936
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OKW88_RS05990 (OKW88_05975) sinI 1212487..1212660 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OKW88_RS05995 (OKW88_05980) sinR 1212694..1213029 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OKW88_RS06000 (OKW88_05985) tasA 1213122..1213907 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  OKW88_RS06005 (OKW88_05990) sipW 1213971..1214543 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OKW88_RS06010 (OKW88_05995) tapA 1214527..1215288 (-) 762 WP_342006576.1 amyloid fiber anchoring/assembly protein TapA -
  OKW88_RS06015 (OKW88_06000) yqzG 1215560..1215886 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OKW88_RS06020 (OKW88_06005) spoIITA 1215928..1216107 (-) 180 WP_072175549.1 YqzE family protein -
  OKW88_RS06025 (OKW88_06010) comGG 1216178..1216552 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  OKW88_RS06030 (OKW88_06015) comGF 1216553..1216936 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  OKW88_RS06035 (OKW88_06020) comGE 1216962..1217309 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  OKW88_RS06040 (OKW88_06025) comGD 1217293..1217724 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  OKW88_RS06045 (OKW88_06030) comGC 1217714..1218010 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  OKW88_RS06050 (OKW88_06035) comGB 1218024..1219061 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  OKW88_RS06055 (OKW88_06040) comGA 1219048..1220118 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  OKW88_RS06060 (OKW88_06045) - 1220331..1220528 (-) 198 WP_342006575.1 hypothetical protein -
  OKW88_RS06065 (OKW88_06050) corA 1220530..1221483 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=752261 OKW88_RS06030 WP_029317913.1 1216553..1216936(-) (comGF) [Bacillus subtilis strain CF03]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=752261 OKW88_RS06030 WP_029317913.1 1216553..1216936(-) (comGF) [Bacillus subtilis strain CF03]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCAATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976