Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OKW88_RS05990 Genome accession   NZ_CP110105
Coordinates   1212487..1212660 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain CF03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1207487..1217660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OKW88_RS05975 (OKW88_05960) gcvT 1208287..1209375 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  OKW88_RS05980 (OKW88_05965) hepAA 1209816..1211489 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  OKW88_RS05985 (OKW88_05970) yqhG 1211510..1212304 (+) 795 WP_003230200.1 YqhG family protein -
  OKW88_RS05990 (OKW88_05975) sinI 1212487..1212660 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OKW88_RS05995 (OKW88_05980) sinR 1212694..1213029 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OKW88_RS06000 (OKW88_05985) tasA 1213122..1213907 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  OKW88_RS06005 (OKW88_05990) sipW 1213971..1214543 (-) 573 WP_003230181.1 signal peptidase I SipW -
  OKW88_RS06010 (OKW88_05995) tapA 1214527..1215288 (-) 762 WP_342006576.1 amyloid fiber anchoring/assembly protein TapA -
  OKW88_RS06015 (OKW88_06000) yqzG 1215560..1215886 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OKW88_RS06020 (OKW88_06005) spoIITA 1215928..1216107 (-) 180 WP_072175549.1 YqzE family protein -
  OKW88_RS06025 (OKW88_06010) comGG 1216178..1216552 (-) 375 WP_029317914.1 ComG operon protein ComGG Machinery gene
  OKW88_RS06030 (OKW88_06015) comGF 1216553..1216936 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  OKW88_RS06035 (OKW88_06020) comGE 1216962..1217309 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=752258 OKW88_RS05990 WP_003230187.1 1212487..1212660(+) (sinI) [Bacillus subtilis strain CF03]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=752258 OKW88_RS05990 WP_003230187.1 1212487..1212660(+) (sinI) [Bacillus subtilis strain CF03]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1