Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   OLL95_RS04495 Genome accession   NZ_CP110054
Coordinates   902471..902998 (+) Length   175 a.a.
NCBI ID   WP_142960522.1    Uniprot ID   -
Organism   Enterococcus faecalis strain BE17     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 891401..939267 902471..902998 within 0


Gene organization within MGE regions


Location: 891401..939267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OLL95_RS04385 (OLL95_04385) - 891401..892582 (-) 1182 WP_231411508.1 site-specific integrase -
  OLL95_RS04390 (OLL95_04390) - 892758..893441 (-) 684 WP_141442172.1 hypothetical protein -
  OLL95_RS04395 (OLL95_04395) - 893531..893764 (+) 234 WP_002367290.1 hypothetical protein -
  OLL95_RS04400 (OLL95_04400) - 893789..894052 (-) 264 Protein_845 toxin -
  OLL95_RS04405 (OLL95_04405) - 894160..894678 (-) 519 WP_002404532.1 hypothetical protein -
  OLL95_RS04410 (OLL95_04410) - 894766..895188 (-) 423 WP_049098636.1 ImmA/IrrE family metallo-endopeptidase -
  OLL95_RS04415 (OLL95_04415) - 895206..895526 (-) 321 WP_002404534.1 helix-turn-helix domain-containing protein -
  OLL95_RS04420 (OLL95_04420) - 895822..896004 (+) 183 WP_002404535.1 hypothetical protein -
  OLL95_RS04425 (OLL95_04425) - 896017..896286 (+) 270 WP_002365131.1 hypothetical protein -
  OLL95_RS04430 (OLL95_04430) - 896320..896526 (+) 207 WP_010822644.1 hypothetical protein -
  OLL95_RS04435 (OLL95_04435) - 896531..896686 (+) 156 WP_010822645.1 hypothetical protein -
  OLL95_RS04440 (OLL95_04440) - 896676..896885 (-) 210 WP_142960439.1 hypothetical protein -
  OLL95_RS04445 (OLL95_04445) - 897064..897486 (-) 423 WP_010828994.1 hypothetical protein -
  OLL95_RS04450 (OLL95_04450) - 897566..898276 (+) 711 WP_104884670.1 Rha family transcriptional regulator -
  OLL95_RS04455 (OLL95_04455) - 898287..898472 (+) 186 WP_002357337.1 hypothetical protein -
  OLL95_RS04460 (OLL95_04460) - 898484..898657 (+) 174 WP_002406302.1 hypothetical protein -
  OLL95_RS04465 (OLL95_04465) - 898855..898977 (+) 123 WP_002399179.1 hypothetical protein -
  OLL95_RS04470 (OLL95_04470) - 898961..899440 (+) 480 WP_002381628.1 siphovirus Gp157 family protein -
  OLL95_RS04475 (OLL95_04475) - 899452..900468 (+) 1017 WP_002365157.1 AAA family ATPase -
  OLL95_RS04480 (OLL95_04480) - 900473..901114 (+) 642 WP_010783684.1 putative HNHc nuclease -
  OLL95_RS04485 (OLL95_04485) - 901182..901604 (+) 423 WP_264547791.1 hypothetical protein -
  OLL95_RS04490 (OLL95_04490) - 901624..902466 (+) 843 WP_264547810.1 DNA replication protein -
  OLL95_RS04495 (OLL95_04495) ssb 902471..902998 (+) 528 WP_142960522.1 single-stranded DNA-binding protein Machinery gene
  OLL95_RS04500 (OLL95_04500) - 903010..903339 (+) 330 WP_174098288.1 hypothetical protein -
  OLL95_RS04505 (OLL95_04505) - 903359..903565 (+) 207 WP_002393799.1 hypothetical protein -
  OLL95_RS04510 (OLL95_04510) - 903618..904382 (+) 765 WP_126268785.1 site-specific DNA-methyltransferase -
  OLL95_RS04515 (OLL95_04515) - 904426..904788 (+) 363 WP_085390508.1 YopX family protein -
  OLL95_RS04520 (OLL95_04520) - 904789..905142 (+) 354 WP_264547792.1 hypothetical protein -
  OLL95_RS04525 (OLL95_04525) - 905312..905503 (+) 192 WP_264547793.1 hypothetical protein -
  OLL95_RS04530 (OLL95_04530) - 905503..905679 (+) 177 WP_185933018.1 hypothetical protein -
  OLL95_RS04535 (OLL95_04535) - 905718..906224 (+) 507 WP_264547794.1 YopX family protein -
  OLL95_RS04540 (OLL95_04540) - 906221..906415 (+) 195 WP_174116374.1 hypothetical protein -
  OLL95_RS04545 (OLL95_04545) - 906412..906660 (+) 249 WP_174116373.1 hypothetical protein -
  OLL95_RS04550 (OLL95_04550) - 906653..906859 (+) 207 WP_174116372.1 hypothetical protein -
  OLL95_RS04555 (OLL95_04555) - 906856..907401 (+) 546 WP_264547795.1 DUF1642 domain-containing protein -
  OLL95_RS04560 (OLL95_04560) - 907402..907563 (+) 162 WP_162837175.1 hypothetical protein -
  OLL95_RS04565 (OLL95_04565) - 907563..907754 (+) 192 WP_264547796.1 hypothetical protein -
  OLL95_RS04570 (OLL95_04570) - 907899..908315 (+) 417 WP_264547797.1 ArpU family phage packaging/lysis transcriptional regulator -
  OLL95_RS04580 (OLL95_04580) - 908847..909461 (+) 615 WP_264547798.1 hypothetical protein -
  OLL95_RS04585 (OLL95_04585) - 910065..910526 (+) 462 WP_002414515.1 terminase small subunit -
  OLL95_RS04590 (OLL95_04590) - 910513..911790 (+) 1278 WP_173944846.1 PBSX family phage terminase large subunit -
  OLL95_RS04595 (OLL95_04595) - 911803..913272 (+) 1470 WP_064687108.1 phage portal protein -
  OLL95_RS04600 (OLL95_04600) - 913250..914296 (+) 1047 WP_202518409.1 phage head morphogenesis protein -
  OLL95_RS04605 (OLL95_04605) - 914299..914619 (+) 321 WP_002414520.1 hypothetical protein -
  OLL95_RS04610 (OLL95_04610) - 914624..914920 (+) 297 WP_164548112.1 hypothetical protein -
  OLL95_RS04615 (OLL95_04615) - 915089..915715 (+) 627 WP_264547799.1 DUF4355 domain-containing protein -
  OLL95_RS04620 (OLL95_04620) - 915729..916631 (+) 903 WP_264547800.1 DUF5309 domain-containing protein -
  OLL95_RS04625 (OLL95_04625) - 916655..916891 (+) 237 WP_002402418.1 hypothetical protein -
  OLL95_RS04630 (OLL95_04630) - 916900..917244 (+) 345 WP_002395886.1 hypothetical protein -
  OLL95_RS04635 (OLL95_04635) - 917241..917618 (+) 378 WP_002404932.1 hypothetical protein -
  OLL95_RS04640 (OLL95_04640) - 917611..918009 (+) 399 WP_002402415.1 HK97 gp10 family phage protein -
  OLL95_RS04645 (OLL95_04645) - 918013..918387 (+) 375 WP_016634615.1 DUF6838 family protein -
  OLL95_RS04650 (OLL95_04650) - 918388..919230 (+) 843 WP_202531045.1 major tail protein -
  OLL95_RS04655 (OLL95_04655) gpG 919283..919636 (+) 354 WP_002364485.1 phage tail assembly chaperone G -
  OLL95_RS04660 (OLL95_04660) - 919885..922782 (+) 2898 WP_264547811.1 tape measure protein -
  OLL95_RS04665 (OLL95_04665) - 922772..923506 (+) 735 WP_002364482.1 tail protein -
  OLL95_RS04670 (OLL95_04670) - 923488..926211 (+) 2724 WP_264547801.1 phage tail spike protein -
  OLL95_RS04675 (OLL95_04675) - 926226..927134 (+) 909 WP_264547802.1 phage baseplate upper protein -
  OLL95_RS04680 (OLL95_04680) - 927127..927444 (+) 318 WP_021732959.1 hypothetical protein -
  OLL95_RS04685 (OLL95_04685) - 927437..927754 (+) 318 WP_021732960.1 hypothetical protein -
  OLL95_RS04690 (OLL95_04690) - 927754..928266 (+) 513 WP_264547803.1 hypothetical protein -
  OLL95_RS04695 (OLL95_04695) - 928281..928655 (+) 375 WP_173944875.1 hypothetical protein -
  OLL95_RS04700 (OLL95_04700) - 928655..928777 (+) 123 WP_002395770.1 XkdX family protein -
  OLL95_RS04705 (OLL95_04705) - 928783..928992 (+) 210 WP_029682685.1 BhlA/UviB family holin-like peptide -
  OLL95_RS04710 (OLL95_04710) - 929034..930137 (+) 1104 WP_264547804.1 SH3 domain-containing protein -
  OLL95_RS04715 (OLL95_04715) - 931097..932161 (+) 1065 WP_002362350.1 FUSC family protein -
  OLL95_RS04720 (OLL95_04720) - 932867..933247 (+) 381 WP_088775801.1 transcriptional regulator -
  OLL95_RS04725 (OLL95_04725) - 933340..934467 (+) 1128 WP_002362348.1 lysozyme -
  OLL95_RS14680 - 935048..935228 (-) 181 Protein_910 hypothetical protein -
  OLL95_RS04730 (OLL95_04730) - 935482..937035 (-) 1554 WP_025186367.1 membrane protein -
  OLL95_RS04735 (OLL95_04735) - 937126..937701 (-) 576 WP_002356327.1 DUF805 domain-containing protein -
  OLL95_RS04740 (OLL95_04740) - 937867..938637 (+) 771 WP_002356329.1 alpha/beta fold hydrolase -
  OLL95_RS04745 (OLL95_04745) - 938725..939267 (+) 543 WP_002362346.1 5-formyltetrahydrofolate cyclo-ligase -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19435.32 Da        Isoelectric Point: 4.6228

>NTDB_id=751850 OLL95_RS04495 WP_142960522.1 902471..902998(+) (ssb) [Enterococcus faecalis strain BE17]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSIQTSQDDSTSVQNDFEGKYTTNQNKGLNQQNNSKQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=751850 OLL95_RS04495 WP_142960522.1 902471..902998(+) (ssb) [Enterococcus faecalis strain BE17]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCAGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTGGAATCAAAAAG
TACAAACGAGAATAGAAATAGCATTCAGACGTCACAGGATGACAGTACAAGCGTTCAAAATGATTTCGAGGGTAAATATA
CCACAAATCAAAACAAAGGCTTAAATCAGCAAAATAATAGCAAACAAATGTCGTTTGGCGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGACGATGATCTACCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.659

100

0.6

  ssbA Bacillus subtilis subsp. subtilis str. 168

56

100

0.56

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

60.571

0.36