Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   OE059_RS04695 Genome accession   NZ_CP109617
Coordinates   888165..888605 (+) Length   146 a.a.
NCBI ID   WP_275060467.1    Uniprot ID   -
Organism   Exiguobacterium profundum strain TSS-3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 878006..915281 888165..888605 within 0


Gene organization within MGE regions


Location: 878006..915281
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OE059_RS04615 (OE059_04615) sufB 878006..879403 (+) 1398 WP_047795116.1 Fe-S cluster assembly protein SufB -
  OE059_RS04620 (OE059_04620) - 879529..880416 (+) 888 WP_275060455.1 hypothetical protein -
  OE059_RS04625 (OE059_04625) - 880452..881660 (-) 1209 WP_275060456.1 tyrosine-type recombinase/integrase -
  OE059_RS04630 (OE059_04630) - 881875..882222 (+) 348 WP_214687155.1 helix-turn-helix domain-containing protein -
  OE059_RS04635 (OE059_04635) - 882245..882772 (+) 528 WP_214687153.1 ImmA/IrrE family metallo-endopeptidase -
  OE059_RS04640 (OE059_04640) - 882953..883111 (+) 159 WP_214687151.1 hypothetical protein -
  OE059_RS04645 (OE059_04645) - 883210..883668 (-) 459 WP_275060457.1 SHOCT domain-containing protein -
  OE059_RS04650 (OE059_04650) - 884240..884644 (-) 405 WP_275060458.1 helix-turn-helix domain-containing protein -
  OE059_RS04655 (OE059_04655) - 884805..885011 (+) 207 WP_275060459.1 helix-turn-helix domain-containing protein -
  OE059_RS04660 (OE059_04660) - 885102..885854 (+) 753 WP_275060460.1 Rha family transcriptional regulator -
  OE059_RS04665 (OE059_04665) - 886029..886427 (+) 399 WP_275060461.1 hypothetical protein -
  OE059_RS04670 (OE059_04670) - 886449..886727 (+) 279 WP_275060462.1 group-specific protein -
  OE059_RS04675 (OE059_04675) - 886823..887023 (+) 201 WP_275060463.1 hypothetical protein -
  OE059_RS04680 (OE059_04680) - 887023..887577 (+) 555 WP_275060464.1 hypothetical protein -
  OE059_RS04685 (OE059_04685) - 887574..887819 (+) 246 WP_275060465.1 hypothetical protein -
  OE059_RS04690 (OE059_04690) - 887794..888168 (+) 375 WP_275060466.1 hypothetical protein -
  OE059_RS04695 (OE059_04695) ssbA 888165..888605 (+) 441 WP_275060467.1 single-stranded DNA-binding protein Machinery gene
  OE059_RS04700 (OE059_04700) - 888639..889715 (+) 1077 WP_275060468.1 DnaD domain protein -
  OE059_RS04705 (OE059_04705) - 889712..889861 (+) 150 WP_214687130.1 hypothetical protein -
  OE059_RS04710 (OE059_04710) - 889858..890187 (+) 330 WP_275060469.1 hypothetical protein -
  OE059_RS04715 (OE059_04715) - 890315..890572 (+) 258 WP_214687126.1 hypothetical protein -
  OE059_RS04720 (OE059_04720) - 890728..891186 (+) 459 WP_275060470.1 hypothetical protein -
  OE059_RS04725 (OE059_04725) - 891183..891725 (+) 543 WP_275060471.1 Holliday junction resolvase RecU -
  OE059_RS04730 (OE059_04730) - 891729..892127 (+) 399 WP_275060472.1 replication terminator protein -
  OE059_RS04735 (OE059_04735) - 892220..892957 (+) 738 WP_275060473.1 hypothetical protein -
  OE059_RS04740 (OE059_04740) - 893252..894166 (+) 915 WP_275060474.1 DUF6731 family protein -
  OE059_RS04745 (OE059_04745) - 894197..894631 (+) 435 WP_275060475.1 hypothetical protein -
  OE059_RS04750 (OE059_04750) - 894992..895327 (+) 336 WP_275060476.1 HNH endonuclease -
  OE059_RS04755 (OE059_04755) - 895317..895445 (+) 129 WP_275060477.1 hypothetical protein -
  OE059_RS04760 (OE059_04760) - 895599..895970 (+) 372 WP_214687719.1 hypothetical protein -
  OE059_RS04765 (OE059_04765) - 895977..897629 (+) 1653 WP_275060478.1 terminase large subunit -
  OE059_RS04770 (OE059_04770) - 897648..898913 (+) 1266 WP_275060479.1 phage portal protein -
  OE059_RS04775 (OE059_04775) - 898873..899481 (+) 609 WP_214687110.1 HK97 family phage prohead protease -
  OE059_RS04780 (OE059_04780) - 899512..900693 (+) 1182 WP_214687109.1 phage major capsid protein -
  OE059_RS04785 (OE059_04785) - 900719..901009 (+) 291 WP_275060480.1 hypothetical protein -
  OE059_RS04790 (OE059_04790) - 901009..901290 (+) 282 WP_275060481.1 head-tail connector protein -
  OE059_RS04795 (OE059_04795) - 901274..901588 (+) 315 WP_275060482.1 hypothetical protein -
  OE059_RS04800 (OE059_04800) - 901578..901979 (+) 402 WP_214687104.1 HK97-gp10 family putative phage morphogenesis protein -
  OE059_RS04805 (OE059_04805) - 901976..902299 (+) 324 WP_214687103.1 hypothetical protein -
  OE059_RS04810 (OE059_04810) - 902315..902878 (+) 564 WP_275060483.1 major tail protein -
  OE059_RS04815 (OE059_04815) - 902995..903339 (+) 345 WP_275060484.1 hypothetical protein -
  OE059_RS04820 (OE059_04820) - 903408..903554 (+) 147 WP_214687097.1 hypothetical protein -
  OE059_RS04825 (OE059_04825) - 903567..907820 (+) 4254 WP_275060485.1 phage tail tape measure protein -
  OE059_RS04830 (OE059_04830) - 907833..908681 (+) 849 WP_275060625.1 phage tail domain-containing protein -
  OE059_RS04835 (OE059_04835) - 908694..909674 (+) 981 WP_275060486.1 hypothetical protein -
  OE059_RS04840 (OE059_04840) - 909677..910462 (+) 786 WP_275060487.1 hypothetical protein -
  OE059_RS04845 (OE059_04845) - 910477..910785 (+) 309 WP_275060488.1 hypothetical protein -
  OE059_RS04850 (OE059_04850) - 910788..911024 (+) 237 WP_275060489.1 hypothetical protein -
  OE059_RS04855 (OE059_04855) - 911131..912312 (+) 1182 WP_275060490.1 siphovirus ReqiPepy6 Gp37-like family protein -
  OE059_RS04860 (OE059_04860) - 912394..912924 (+) 531 WP_275060491.1 phage holin family protein -
  OE059_RS04865 (OE059_04865) - 912921..913553 (+) 633 WP_275060492.1 M23 family metallopeptidase -
  OE059_RS04870 (OE059_04870) - 913939..914118 (-) 180 WP_214687082.1 hypothetical protein -
  OE059_RS04875 (OE059_04875) - 914521..914862 (+) 342 WP_214757531.1 hypothetical protein -
  OE059_RS04880 (OE059_04880) - 914859..915281 (+) 423 WP_251025524.1 DUF6678 family protein -

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 16124.92 Da        Isoelectric Point: 4.9895

>NTDB_id=748602 OE059_RS04695 WP_275060467.1 888165..888605(+) (ssbA) [Exiguobacterium profundum strain TSS-3]
MINRIVLVGRLTRDPEMRYTQSGIAVTRFTLACDRPFSGQDGKREADFIDCVVWRKQAENVSKYLSKGSMAGVDGRLQIS
SYEGQDGQKRYRAEVVADGVRFLSSKGDGRDSAPPPRDDEAPQAKGGFDQQPYSGGIDLSDDDLPF

Nucleotide


Download         Length: 441 bp        

>NTDB_id=748602 OE059_RS04695 WP_275060467.1 888165..888605(+) (ssbA) [Exiguobacterium profundum strain TSS-3]
ATGATCAACCGAATCGTATTAGTGGGAAGGCTGACACGAGACCCTGAGATGCGCTACACCCAGTCGGGCATCGCCGTGAC
ACGCTTCACGCTCGCCTGTGACCGCCCTTTCAGCGGACAGGACGGGAAACGGGAGGCGGACTTCATCGATTGCGTCGTCT
GGCGCAAGCAGGCGGAGAACGTATCGAAGTATCTATCGAAAGGGAGCATGGCCGGCGTCGACGGTCGTCTCCAAATCAGC
AGTTACGAAGGACAGGACGGACAGAAACGATATCGCGCCGAGGTCGTCGCGGACGGTGTGCGCTTCCTCAGCTCCAAAGG
TGATGGGCGCGACAGTGCACCGCCACCGAGGGACGATGAAGCGCCACAGGCAAAAGGTGGATTCGACCAACAACCTTACT
CGGGTGGCATCGATTTGTCAGATGATGATTTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

45.349

100

0.534

  ssb Latilactobacillus sakei subsp. sakei 23K

45.614

100

0.534

  ssbB Bacillus subtilis subsp. subtilis str. 168

47.107

82.877

0.39