Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   NDN54_RS08530 Genome accession   NZ_CP107266
Coordinates   1619619..1620014 (-) Length   131 a.a.
NCBI ID   WP_003703428.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 9112     
Function   DNA binding (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1586284..1618833 1619619..1620014 flank 786


Gene organization within MGE regions


Location: 1586284..1620014
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDN54_RS08260 (NDN54_08260) - 1586312..1587286 (-) 975 WP_003689550.1 SIS domain-containing protein -
  NDN54_RS08265 (NDN54_08265) tal 1587383..1588438 (+) 1056 WP_003695503.1 transaldolase -
  NDN54_RS08270 (NDN54_08270) - 1588450..1588584 (+) 135 WP_012503902.1 hypothetical protein -
  NDN54_RS08275 (NDN54_08275) - 1588589..1588879 (+) 291 WP_003689553.1 hypothetical protein -
  NDN54_RS08280 (NDN54_08280) gluQRS 1588896..1589783 (+) 888 WP_003689554.1 tRNA glutamyl-Q(34) synthetase GluQRS -
  NDN54_RS08285 (NDN54_08285) dusA 1589853..1590869 (-) 1017 WP_003689555.1 tRNA dihydrouridine(20/20a) synthase DusA -
  NDN54_RS08290 (NDN54_08290) - 1590989..1592143 (+) 1155 WP_003693486.1 tyrosine-type recombinase/integrase -
  NDN54_RS08295 (NDN54_08295) - 1592193..1592459 (-) 267 WP_003689557.1 pyocin activator PrtN family protein -
  NDN54_RS08300 (NDN54_08300) - 1592567..1593715 (-) 1149 WP_003705649.1 hypothetical protein -
  NDN54_RS08305 (NDN54_08305) - 1593712..1594695 (-) 984 WP_041421310.1 phage associated protein -
  NDN54_RS08310 (NDN54_08310) - 1594806..1595021 (-) 216 WP_003691538.1 hypothetical protein -
  NDN54_RS08315 (NDN54_08315) - 1595073..1595564 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  NDN54_RS08320 (NDN54_08320) - 1595561..1595743 (-) 183 WP_003691535.1 hypothetical protein -
  NDN54_RS08325 (NDN54_08325) - 1595883..1596569 (-) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  NDN54_RS08330 (NDN54_08330) - 1596638..1596799 (-) 162 WP_003691530.1 hypothetical protein -
  NDN54_RS08335 (NDN54_08335) - 1596796..1597074 (-) 279 WP_041421244.1 NGO1622 family putative holin -
  NDN54_RS08340 (NDN54_08340) - 1597227..1597559 (-) 333 WP_003687946.1 hypothetical protein -
  NDN54_RS08345 (NDN54_08345) - 1597700..1597987 (-) 288 WP_041421246.1 hypothetical protein -
  NDN54_RS08350 (NDN54_08350) - 1597984..1598460 (-) 477 WP_012504141.1 DUF6948 domain-containing protein -
  NDN54_RS08355 (NDN54_08355) - 1598493..1598693 (-) 201 WP_003704298.1 hypothetical protein -
  NDN54_RS08360 (NDN54_08360) - 1599178..1599396 (+) 219 WP_003691731.1 hypothetical protein -
  NDN54_RS08365 (NDN54_08365) - 1599413..1599772 (-) 360 WP_003691733.1 hypothetical protein -
  NDN54_RS08370 (NDN54_08370) - 1599773..1600312 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  NDN54_RS08375 (NDN54_08375) - 1600472..1601176 (-) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  NDN54_RS08380 (NDN54_08380) - 1601304..1601519 (+) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  NDN54_RS08385 (NDN54_08385) - 1601599..1601754 (+) 156 WP_003703527.1 hypothetical protein -
  NDN54_RS08390 (NDN54_08390) - 1601731..1601919 (-) 189 WP_003698903.1 hypothetical protein -
  NDN54_RS08395 (NDN54_08395) - 1602092..1602319 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NDN54_RS08400 (NDN54_08400) - 1602316..1602453 (+) 138 WP_010359998.1 hypothetical protein -
  NDN54_RS08405 (NDN54_08405) - 1602437..1603501 (+) 1065 WP_003689134.1 hypothetical protein -
  NDN54_RS08410 (NDN54_08410) - 1603498..1604859 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NDN54_RS08415 (NDN54_08415) - 1604876..1605106 (+) 231 WP_012503490.1 hypothetical protein -
  NDN54_RS08420 (NDN54_08420) - 1605197..1605691 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  NDN54_RS08425 (NDN54_08425) - 1606073..1606222 (+) 150 WP_041421445.1 hypothetical protein -
  NDN54_RS08430 (NDN54_08430) - 1606251..1606532 (+) 282 WP_003689109.1 hypothetical protein -
  NDN54_RS08435 (NDN54_08435) - 1606523..1606903 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  NDN54_RS08440 (NDN54_08440) - 1607232..1608194 (-) 963 WP_048596800.1 IS110 family transposase -
  NDN54_RS08445 (NDN54_08445) - 1608720..1609079 (-) 360 WP_003689732.1 hypothetical protein -
  NDN54_RS08450 (NDN54_08450) - 1609200..1610272 (-) 1073 Protein_1635 zonular occludens toxin domain-containing protein -
  NDN54_RS08455 (NDN54_08455) - 1610282..1610572 (-) 291 WP_012503936.1 DUF2523 domain-containing protein -
  NDN54_RS08460 (NDN54_08460) - 1610551..1612140 (-) 1590 WP_172761357.1 IgG-binding virulence factor TspB family protein -
  NDN54_RS08465 (NDN54_08465) - 1612082..1612399 (-) 318 WP_003689167.1 DUF1132 family protein -
  NDN54_RS08470 (NDN54_08470) - 1612527..1612805 (-) 279 WP_003691583.1 hypothetical protein -
  NDN54_RS08475 (NDN54_08475) - 1612812..1613030 (-) 219 WP_003691584.1 major capsid protein -
  NDN54_RS08480 (NDN54_08480) - 1613104..1613301 (-) 198 WP_003689600.1 hypothetical protein -
  NDN54_RS08485 (NDN54_08485) - 1613306..1613596 (-) 291 WP_012503914.1 hypothetical protein -
  NDN54_RS08490 (NDN54_08490) - 1613641..1614990 (-) 1350 WP_025455830.1 replication initiation factor domain-containing protein -
  NDN54_RS08495 (NDN54_08495) - 1615129..1615551 (-) 423 WP_003691751.1 very short patch repair endonuclease -
  NDN54_RS08500 (NDN54_08500) - 1615557..1616153 (-) 597 WP_012503916.1 TIGR02391 family protein -
  NDN54_RS08505 (NDN54_08505) - 1616343..1617200 (-) 858 WP_012503917.1 ATP-binding protein -
  NDN54_RS08510 (NDN54_08510) - 1617214..1617648 (-) 435 WP_229684538.1 DNA cytosine methyltransferase -
  NDN54_RS08515 (NDN54_08515) - 1617582..1618190 (-) 609 WP_080229275.1 DNA cytosine methyltransferase -
  NDN54_RS08520 (NDN54_08520) - 1618559..1618705 (+) 147 WP_003691757.1 hypothetical protein -
  NDN54_RS08525 (NDN54_08525) comP 1619082..1619531 (-) 450 WP_002214937.1 type IV pilin protein Machinery gene
  NDN54_RS08530 (NDN54_08530) comE 1619619..1620014 (-) 396 WP_003703428.1 helix-hairpin-helix domain-containing protein Machinery gene

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 13796.61 Da        Isoelectric Point: 10.8790

>NTDB_id=738932 NDN54_RS08530 WP_003703428.1 1619619..1620014(-) (comE) [Neisseria gonorrhoeae strain 9112]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide


Download         Length: 396 bp        

>NTDB_id=738932 NDN54_RS08530 WP_003703428.1 1619619..1620014(-) (comE) [Neisseria gonorrhoeae strain 9112]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains


Predicted by InterproScan.

(52-110)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1