Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | NDN54_RS02685 | Genome accession | NZ_CP107266 |
| Coordinates | 521074..521547 (+) | Length | 157 a.a. |
| NCBI ID | WP_012503482.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 9112 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 516546..560451 | 521074..521547 | within | 0 |
Gene organization within MGE regions
Location: 516546..560451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN54_RS02660 (NDN54_02660) | dnaB | 516546..517949 (+) | 1404 | WP_012503477.1 | replicative DNA helicase | - |
| NDN54_RS12060 | - | 517943..518055 (-) | 113 | Protein_517 | IS5/IS1182 family transposase | - |
| NDN54_RS02665 (NDN54_02665) | pilH | 518206..518880 (+) | 675 | WP_260239863.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| NDN54_RS02670 (NDN54_02670) | pilI | 518912..519526 (+) | 615 | WP_012503479.1 | type IV pilus modification protein PilV | Machinery gene |
| NDN54_RS02675 (NDN54_02675) | pilJ | 519523..520482 (+) | 960 | WP_012503480.1 | PilW family protein | Machinery gene |
| NDN54_RS02680 (NDN54_02680) | pilK | 520461..521072 (+) | 612 | WP_012503481.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| NDN54_RS02685 (NDN54_02685) | pilL | 521074..521547 (+) | 474 | WP_012503482.1 | PilX family type IV pilin | Machinery gene |
| NDN54_RS02690 (NDN54_02690) | - | 521617..521925 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| NDN54_RS02695 (NDN54_02695) | - | 521922..522633 (-) | 712 | Protein_524 | AzlC family ABC transporter permease | - |
| NDN54_RS02700 (NDN54_02700) | dut | 522799..523251 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| NDN54_RS02705 (NDN54_02705) | dapC | 523323..524510 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| NDN54_RS02710 (NDN54_02710) | yaaA | 524666..525445 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| NDN54_RS02725 (NDN54_02725) | - | 525975..527175 (+) | 1201 | Protein_528 | tyrosine-type recombinase/integrase | - |
| NDN54_RS02730 (NDN54_02730) | - | 527531..527800 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| NDN54_RS02735 (NDN54_02735) | - | 527995..528678 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| NDN54_RS11890 | - | 528959..529225 (-) | 267 | Protein_531 | hypothetical protein | - |
| NDN54_RS02745 (NDN54_02745) | - | 529336..529551 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| NDN54_RS02750 (NDN54_02750) | - | 529603..530094 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| NDN54_RS02755 (NDN54_02755) | - | 530091..530273 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| NDN54_RS02760 (NDN54_02760) | - | 530413..531099 (-) | 687 | WP_010359969.1 | phage replication initiation protein, NGO0469 family | - |
| NDN54_RS02765 (NDN54_02765) | - | 531168..531329 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| NDN54_RS02770 (NDN54_02770) | - | 531326..531604 (-) | 279 | WP_041421244.1 | NGO1622 family putative holin | - |
| NDN54_RS02775 (NDN54_02775) | - | 531757..532089 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| NDN54_RS02780 (NDN54_02780) | - | 532230..532517 (-) | 288 | WP_041421246.1 | hypothetical protein | - |
| NDN54_RS02785 (NDN54_02785) | - | 532514..532990 (-) | 477 | WP_012504141.1 | DUF6948 domain-containing protein | - |
| NDN54_RS02790 (NDN54_02790) | - | 533023..533223 (-) | 201 | WP_003704298.1 | hypothetical protein | - |
| NDN54_RS02795 (NDN54_02795) | - | 533421..533834 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| NDN54_RS02800 (NDN54_02800) | - | 533831..534292 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| NDN54_RS02805 (NDN54_02805) | - | 534309..534746 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| NDN54_RS02810 (NDN54_02810) | - | 534861..535577 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| NDN54_RS02815 (NDN54_02815) | - | 535652..535882 (+) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| NDN54_RS02820 (NDN54_02820) | - | 535962..536117 (+) | 156 | WP_003691446.1 | hypothetical protein | - |
| NDN54_RS02825 (NDN54_02825) | - | 536094..536282 (-) | 189 | WP_003698903.1 | hypothetical protein | - |
| NDN54_RS02830 (NDN54_02830) | - | 536455..536682 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| NDN54_RS02835 (NDN54_02835) | - | 536679..536816 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| NDN54_RS02840 (NDN54_02840) | - | 536800..537864 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| NDN54_RS02845 (NDN54_02845) | - | 537861..539222 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NDN54_RS02850 (NDN54_02850) | - | 539239..539469 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| NDN54_RS02855 (NDN54_02855) | - | 539560..540054 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| NDN54_RS02860 (NDN54_02860) | - | 540436..540585 (+) | 150 | WP_041421445.1 | hypothetical protein | - |
| NDN54_RS02865 (NDN54_02865) | - | 540614..540895 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| NDN54_RS02870 (NDN54_02870) | - | 540886..541323 (+) | 438 | WP_047918627.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NDN54_RS02875 (NDN54_02875) | - | 541316..541621 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| NDN54_RS02880 (NDN54_02880) | - | 541618..542001 (+) | 384 | WP_003687982.1 | recombination protein NinB | - |
| NDN54_RS02885 (NDN54_02885) | - | 541992..542510 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| NDN54_RS02890 (NDN54_02890) | - | 542575..542997 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| NDN54_RS02895 (NDN54_02895) | - | 542997..543536 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| NDN54_RS02900 (NDN54_02900) | - | 543517..544791 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| NDN54_RS02905 (NDN54_02905) | - | 544776..547043 (+) | 2268 | WP_228369784.1 | hypothetical protein | - |
| NDN54_RS02910 (NDN54_02910) | - | 547280..548476 (+) | 1197 | WP_003687992.1 | hypothetical protein | - |
| NDN54_RS02915 (NDN54_02915) | - | 548473..549687 (+) | 1215 | WP_044270986.1 | hypothetical protein | - |
| NDN54_RS12065 | - | 549890..555799 (+) | 5910 | WP_033909227.1 | PLxRFG domain-containing protein | - |
| NDN54_RS02930 (NDN54_02930) | - | 556425..557720 (+) | 1296 | WP_047924264.1 | DUF4043 family protein | - |
| NDN54_RS02935 (NDN54_02935) | - | 557775..558248 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| NDN54_RS02940 (NDN54_02940) | - | 558254..558739 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| NDN54_RS02945 (NDN54_02945) | - | 558736..559410 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| NDN54_RS02950 (NDN54_02950) | - | 559413..559562 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| NDN54_RS02955 (NDN54_02955) | - | 559600..560451 (-) | 852 | WP_260239864.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17486.30 Da Isoelectric Point: 9.9561
>NTDB_id=738916 NDN54_RS02685 WP_012503482.1 521074..521547(+) (pilL) [Neisseria gonorrhoeae strain 9112]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=738916 NDN54_RS02685 WP_012503482.1 521074..521547(+) (pilL) [Neisseria gonorrhoeae strain 9112]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.72 |
100 |
0.917 |
| pilX | Neisseria meningitidis 8013 |
85.35 |
100 |
0.854 |