Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   NDN54_RS02680 Genome accession   NZ_CP107266
Coordinates   520461..521072 (+) Length   203 a.a.
NCBI ID   WP_012503481.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 9112     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 516546..560451 520461..521072 within 0


Gene organization within MGE regions


Location: 516546..560451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDN54_RS02660 (NDN54_02660) dnaB 516546..517949 (+) 1404 WP_012503477.1 replicative DNA helicase -
  NDN54_RS12060 - 517943..518055 (-) 113 Protein_517 IS5/IS1182 family transposase -
  NDN54_RS02665 (NDN54_02665) pilH 518206..518880 (+) 675 WP_260239863.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  NDN54_RS02670 (NDN54_02670) pilI 518912..519526 (+) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  NDN54_RS02675 (NDN54_02675) pilJ 519523..520482 (+) 960 WP_012503480.1 PilW family protein Machinery gene
  NDN54_RS02680 (NDN54_02680) pilK 520461..521072 (+) 612 WP_012503481.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  NDN54_RS02685 (NDN54_02685) pilL 521074..521547 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  NDN54_RS02690 (NDN54_02690) - 521617..521925 (-) 309 WP_003706588.1 AzlD family protein -
  NDN54_RS02695 (NDN54_02695) - 521922..522633 (-) 712 Protein_524 AzlC family ABC transporter permease -
  NDN54_RS02700 (NDN54_02700) dut 522799..523251 (+) 453 WP_003701071.1 dUTP diphosphatase -
  NDN54_RS02705 (NDN54_02705) dapC 523323..524510 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  NDN54_RS02710 (NDN54_02710) yaaA 524666..525445 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  NDN54_RS02725 (NDN54_02725) - 525975..527175 (+) 1201 Protein_528 tyrosine-type recombinase/integrase -
  NDN54_RS02730 (NDN54_02730) - 527531..527800 (-) 270 WP_003687928.1 hypothetical protein -
  NDN54_RS02735 (NDN54_02735) - 527995..528678 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  NDN54_RS11890 - 528959..529225 (-) 267 Protein_531 hypothetical protein -
  NDN54_RS02745 (NDN54_02745) - 529336..529551 (-) 216 WP_003691538.1 hypothetical protein -
  NDN54_RS02750 (NDN54_02750) - 529603..530094 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  NDN54_RS02755 (NDN54_02755) - 530091..530273 (-) 183 WP_003691535.1 hypothetical protein -
  NDN54_RS02760 (NDN54_02760) - 530413..531099 (-) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  NDN54_RS02765 (NDN54_02765) - 531168..531329 (-) 162 WP_003691530.1 hypothetical protein -
  NDN54_RS02770 (NDN54_02770) - 531326..531604 (-) 279 WP_041421244.1 NGO1622 family putative holin -
  NDN54_RS02775 (NDN54_02775) - 531757..532089 (-) 333 WP_003687946.1 hypothetical protein -
  NDN54_RS02780 (NDN54_02780) - 532230..532517 (-) 288 WP_041421246.1 hypothetical protein -
  NDN54_RS02785 (NDN54_02785) - 532514..532990 (-) 477 WP_012504141.1 DUF6948 domain-containing protein -
  NDN54_RS02790 (NDN54_02790) - 533023..533223 (-) 201 WP_003704298.1 hypothetical protein -
  NDN54_RS02795 (NDN54_02795) - 533421..533834 (-) 414 WP_003687963.1 hypothetical protein -
  NDN54_RS02800 (NDN54_02800) - 533831..534292 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  NDN54_RS02805 (NDN54_02805) - 534309..534746 (-) 438 WP_003687967.1 hypothetical protein -
  NDN54_RS02810 (NDN54_02810) - 534861..535577 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  NDN54_RS02815 (NDN54_02815) - 535652..535882 (+) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  NDN54_RS02820 (NDN54_02820) - 535962..536117 (+) 156 WP_003691446.1 hypothetical protein -
  NDN54_RS02825 (NDN54_02825) - 536094..536282 (-) 189 WP_003698903.1 hypothetical protein -
  NDN54_RS02830 (NDN54_02830) - 536455..536682 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NDN54_RS02835 (NDN54_02835) - 536679..536816 (+) 138 WP_010359998.1 hypothetical protein -
  NDN54_RS02840 (NDN54_02840) - 536800..537864 (+) 1065 WP_003689134.1 hypothetical protein -
  NDN54_RS02845 (NDN54_02845) - 537861..539222 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NDN54_RS02850 (NDN54_02850) - 539239..539469 (+) 231 WP_012503490.1 hypothetical protein -
  NDN54_RS02855 (NDN54_02855) - 539560..540054 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  NDN54_RS02860 (NDN54_02860) - 540436..540585 (+) 150 WP_041421445.1 hypothetical protein -
  NDN54_RS02865 (NDN54_02865) - 540614..540895 (+) 282 WP_003689109.1 hypothetical protein -
  NDN54_RS02870 (NDN54_02870) - 540886..541323 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  NDN54_RS02875 (NDN54_02875) - 541316..541621 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  NDN54_RS02880 (NDN54_02880) - 541618..542001 (+) 384 WP_003687982.1 recombination protein NinB -
  NDN54_RS02885 (NDN54_02885) - 541992..542510 (+) 519 WP_003687984.1 HNH endonuclease -
  NDN54_RS02890 (NDN54_02890) - 542575..542997 (+) 423 WP_003690919.1 hypothetical protein -
  NDN54_RS02895 (NDN54_02895) - 542997..543536 (+) 540 WP_003690920.1 hypothetical protein -
  NDN54_RS02900 (NDN54_02900) - 543517..544791 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  NDN54_RS02905 (NDN54_02905) - 544776..547043 (+) 2268 WP_228369784.1 hypothetical protein -
  NDN54_RS02910 (NDN54_02910) - 547280..548476 (+) 1197 WP_003687992.1 hypothetical protein -
  NDN54_RS02915 (NDN54_02915) - 548473..549687 (+) 1215 WP_044270986.1 hypothetical protein -
  NDN54_RS12065 - 549890..555799 (+) 5910 WP_033909227.1 PLxRFG domain-containing protein -
  NDN54_RS02930 (NDN54_02930) - 556425..557720 (+) 1296 WP_047924264.1 DUF4043 family protein -
  NDN54_RS02935 (NDN54_02935) - 557775..558248 (+) 474 WP_003690936.1 hypothetical protein -
  NDN54_RS02940 (NDN54_02940) - 558254..558739 (+) 486 WP_003687997.1 hypothetical protein -
  NDN54_RS02945 (NDN54_02945) - 558736..559410 (+) 675 WP_003687998.1 hypothetical protein -
  NDN54_RS02950 (NDN54_02950) - 559413..559562 (+) 150 WP_003706419.1 hypothetical protein -
  NDN54_RS02955 (NDN54_02955) - 559600..560451 (-) 852 WP_260239864.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 203 a.a.        Molecular weight: 22021.91 Da        Isoelectric Point: 8.0862

>NTDB_id=738915 NDN54_RS02680 WP_012503481.1 520461..521072(+) (pilK) [Neisseria gonorrhoeae strain 9112]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=738915 NDN54_RS02680 WP_012503481.1 520461..521072(+) (pilK) [Neisseria gonorrhoeae strain 9112]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

96.059

100

0.961