NTDB

Overview

Name	comE	Type	Machinery gene
Locus tag	OE961_RS08305	Genome accession	NZ_CP107223
Coordinates	1577478..1577873 (-)	Length	131 a.a.
NCBI ID	WP_003703428.1	Uniprot ID	-
Organism	Neisseria gonorrhoeae strain H035
Function	DNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1570388..1584670	1577478..1577873	within	0

Gene organization within MGE regions

Location: 1570388..1584670

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OE961_RS08245 (OE961_08245)	-	1570388..1570666 (-)	279	WP_003691583.1	hypothetical protein	-
OE961_RS08250 (OE961_08250)	-	1570673..1570891 (-)	219	WP_003691584.1	major capsid protein	-
OE961_RS08255 (OE961_08255)	-	1570965..1571162 (-)	198	WP_003689600.1	hypothetical protein	-
OE961_RS08260 (OE961_08260)	-	1571167..1571457 (-)	291	WP_012503914.1	hypothetical protein	-
OE961_RS08265 (OE961_08265)	-	1571502..1572849 (-)	1348	Protein_1594	replication initiation factor domain-containing protein	-
OE961_RS08270 (OE961_08270)	-	1572988..1573410 (-)	423	WP_003691751.1	very short patch repair endonuclease	-
OE961_RS08275 (OE961_08275)	-	1573416..1574012 (-)	597	WP_012503916.1	TIGR02391 family protein	-
OE961_RS08280 (OE961_08280)	-	1574202..1575059 (-)	858	WP_012503917.1	ATP-binding protein	-
OE961_RS08285 (OE961_08285)	-	1575073..1575444 (-)	372	WP_012503918.1	DNA cytosine methyltransferase	-
OE961_RS08290 (OE961_08290)	-	1575441..1576049 (-)	609	WP_080229275.1	DNA cytosine methyltransferase	-
OE961_RS08295 (OE961_08295)	-	1576418..1576564 (+)	147	WP_003691757.1	hypothetical protein	-
OE961_RS08300 (OE961_08300)	comP	1576941..1577390 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
OE961_RS08305 (OE961_08305)	comE	1577478..1577873 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
OE961_RS08310 (OE961_08310)	-	1577978..1578094 (-)	117	Protein_1603	competence protein ComE	-
OE961_RS08340 (OE961_08340)	-	1583719..1584372 (-)	654	Protein_1604	TIGR01621 family pseudouridine synthase	-
OE961_RS08345 (OE961_08345)	-	1584326..1584670 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 13796.61 Da Isoelectric Point: 10.8790

                                >NTDB_id=738659 OE961_RS08305 WP_003703428.1 1577478..1577873(-) (comE) [Neisseria gonorrhoeae strain H035]

MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY

RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide

Download Length: 396 bp

                                >NTDB_id=738659 OE961_RS08305 WP_003703428.1 1577478..1577873(-) (comE) [Neisseria gonorrhoeae strain H035]

TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC

CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA

ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC

CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT

GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(52-110)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1

Detailed information NTG0738659